KEGG   Homo sapiens (human): 3853
Entry
3853              CDS       T01001                                 
Symbol
KRT6A, CK-6C, CK-6E, CK6A, CK6C, CK6D, K6A, K6C, K6D, KRT6C, KRT6D, PC3
Name
(RefSeq) keratin 6A
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00684  Pachyonychia congenita
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3853 (KRT6A)
   04147 Exosome [BR:hsa04147]
    3853 (KRT6A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3853 (KRT6A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3853 (KRT6A)
  Exosomal proteins of other body fluids (saliva and urine)
   3853 (KRT6A)
  Exosomal proteins of colorectal cancer cells
   3853 (KRT6A)
  Exosomal proteins of bladder cancer cells
   3853 (KRT6A)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 CENP-F_leu_zip Taxilin DUF745 DUF5819 UPF0184 ATG16 FapA OmpH ADIP Alanine_zipper Baculo_PEP_C APG6_N
Other DBs
NCBI-GeneID: 3853
NCBI-ProteinID: NP_005545
OMIM: 148041
HGNC: 6443
Ensembl: ENSG00000205420
Pharos: P02538(Tbio)
UniProt: P02538 A0A0S2Z428
Structure
Position
12:complement(52487176..52493257)
AA seq 564 aa
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR
GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggccagcacatccaccaccatcaggagccacagcagcagccgccggggtttcagtgcc
aactcagccaggctccctggggtcagccgctctggcttcagcagcgtctccgtgtcccgc
tccaggggcagtggtggcctgggtggtgcatgtggaggagctggctttggcagccgcagt
ctgtatggcctggggggctccaagaggatctccattggagggggcagctgtgccatcagt
ggcggctatggcagcagagccggaggcagctatggctttggtggcgccgggagtggattt
ggtttcggtggtggagccggcattggctttggtctgggtggtggagccggccttgctggt
ggctttgggggccctggcttccctgtgtgcccccctggaggcatccaagaggtcaccgtc
aaccagagtctcctgactcccctcaacctgcaaatcgatcccaccatccagcgggtgcgg
gctgaggagcgtgaacagatcaagaccctcaacaacaagtttgcctccttcatcgacaag
gtgcggttcctggagcagcagaacaaggttctggaaacaaagtggaccctgctgcaggag
cagggcaccaagactgtgaggcagaacctggagccgttgttcgagcagtacatcaacaac
ctcaggaggcagctggacagcattgtcggggaacggggccgcctggactcagagctcaga
ggcatgcaggacctggtggaggacttcaagaacaaatatgaggatgaaatcaacaagcgc
acagcagcagagaatgaatttgtgactctgaagaaggatgtggatgctgcctacatgaac
aaggttgaactgcaagccaaggcagacactctcacagacgagatcaacttcctgagagcc
ttgtatgatgcagagctgtcccagatgcagacccacatctcagacacatctgtggtgctg
tccatggacaacaaccgcaacctggacctggacagcatcatcgctgaggtcaaggcccaa
tatgaggagattgctcagagaagccgggctgaggctgagtcctggtaccagaccaagtac
gaggagctgcaggtcacagcaggcagacatggggacgacctgcgcaacaccaagcaggag
attgctgagatcaaccgcatgatccagaggctgagatctgagatcgaccacgtcaagaag
cagtgcgccaacctgcaggccgccattgctgatgctgagcagcgtggggagatggccctc
aaggatgccaagaacaagctggaagggctggaggatgccctgcagaaggccaagcaggac
ctggcccggctgctgaaggagtaccaggagctgatgaatgtcaagctggccctggacgtg
gagatcgccacctaccgcaagctgctggagggtgaggagtgcaggctgaatggcgaaggc
gttggacaagtcaacatctctgtggtgcagtccaccgtctccagtggctatggcggtgcc
agtggtgtcggcagtggcttaggcctgggtggaggaagcagctactcctatggcagtggt
cttggcgttggaggtggcttcagttccagcagtggcagagccattgggggtggcctcagc
tctgttggaggcggcagttccaccatcaagtacaccaccacctcctcctccagcaggaag
agctataagcactaa

DBGET integrated database retrieval system