KEGG   Homo sapiens (human): 3855
Entry
3855              CDS       T01001                                 

Symbol
KRT7, CK7, K2C7, K7, SCL
Name
(RefSeq) keratin 7
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3855 (KRT7)
   04147 Exosome [BR:hsa04147]
    3855 (KRT7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3855 (KRT7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3855 (KRT7)
  Exosomal proteins of other body fluids (saliva and urine)
   3855 (KRT7)
  Exosomal proteins of colorectal cancer cells
   3855 (KRT7)
  Exosomal proteins of bladder cancer cells
   3855 (KRT7)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Spc7 TSNAXIP1_N CENP-F_leu_zip DUF5082 Prefoldin ATG16 ADIP Baculo_PEP_C JAKMIP_CC3 LPP
Other DBs
NCBI-GeneID: 3855
NCBI-ProteinID: NP_005547
OMIM: 148059
HGNC: 6445
Ensembl: ENSG00000135480
Vega: OTTHUMG00000169580
Pharos: P08729(Tbio)
UniProt: P08729
Position
12q13.13
AA seq 469 aa
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE
TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI
SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtccatccacttcagctccccggtattcacctcgcgctcagccgccttctcgggccgc
ggcgcccaggtgcgcctgagctccgctcgccccggcggccttggcagcagcagcctctac
ggcctcggcgcctcacggccgcgcgtggccgtgcgctctgcctatgggggcccggtgggc
gccggcatccgcgaggtcaccattaaccagagcctgctggccccgctgcggctggacgcc
gacccctccctccagcgggtgcgccaggaggagagcgagcagatcaagaccctcaacaac
aagtttgcctccttcatcgacaaggtgcggtttctggagcagcagaacaagctgctggag
accaagtggacgctgctgcaggagcagaagtcggccaagagcagccgcctcccagacatc
tttgaggcccagattgctggccttcggggtcagcttgaggcactgcaggtggatgggggc
cgcctggaggcggagctgcggagcatgcaggatgtggtggaggacttcaagaataagtac
gaagatgaaattaaccaccgcacagctgctgagaatgagtttgtggtgctgaagaaggat
gtggatgctgcctacatgagcaaggtggagctggaggccaaggtggatgccctgaatgat
gagatcaacttcctcaggaccctcaatgagacggagttgacagagctgcagtcccagatc
tccgacacatctgtggtgctgtccatggacaacagtcgctccctggacctggacggcatc
atcgctgaggtcaaggcgcagtatgaggagatggccaaatgcagccgggctgaggctgaa
gcctggtaccagaccaagtttgagaccctccaggcccaggctgggaagcatggggacgac
ctccggaatacccggaatgagatttcagagatgaaccgggccatccagaggctgcaggct
gagatcgacaacatcaagaaccagcgtgccaagttggaggccgccattgccgaggctgag
gagcgtggggagctggcgctcaaggatgctcgtgccaagcaggaggagctggaagccgcc
ctgcagcggggcaagcaggatatggcacggcagctgcgtgagtaccaggaactcatgagc
gtgaagctggccctggacatcgagatcgccacctaccgcaagctgctggagggcgaggag
agccggttggctggagatggagtgggagccgtgaatatctctgtgatgaattccactggt
ggcagtagcagtggcggtggcattgggctgaccctcgggggaaccatgggcagcaatgcc
ctgagcttctccagcagtgcgggtcctgggctcctgaaggcttattccatccggaccgca
tccgccagtcgcaggagtgcccgcgactga

DBGET integrated database retrieval system