KEGG   Homo sapiens (human): 3856
Entry
3856              CDS       T01001                                 

Gene name
KRT8, CARD2, CK-8, CK8, CYK8, K2C8, K8, KO
Definition
(RefSeq) keratin 8
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H02225  Familial cirrhosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3856 (KRT8)
   04147 Exosome [BR:hsa04147]
    3856 (KRT8)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3856 (KRT8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3856 (KRT8)
  Exosomal proteins of other body fluids (saliva and urine)
   3856 (KRT8)
  Exosomal proteins of colorectal cancer cells
   3856 (KRT8)
  Exosomal proteins of bladder cancer cells
   3856 (KRT8)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 Spc7 ADIP CALCOCO1 TraC TolA_bind_tri Taxilin DivIC ABC_tran_CTD
Other DBs
NCBI-GeneID: 3856
NCBI-ProteinID: NP_001243222
OMIM: 148060
HGNC: 6446
Ensembl: ENSG00000170421
Vega: OTTHUMG00000169881
Pharos: P05787(Tbio)
UniProt: P05787
Position
12q13.13
AA seq 483 aa
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGM
GGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE
TKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYE
DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL
RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAAL
QRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA
GGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV
LPK
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtccatcagggtgacccagaagtcctacaaggtgtccacctctggcccccgggccttc
agcagccgctcctacacgagtgggcccggttcccgcatcagctcctcgagcttctcccga
gtgggcagcagcaactttcgcggtggcctgggcggcggctatggtggggccagcggcatg
ggaggcatcaccgcagttacggtcaaccagagcctgctgagcccccttgtcctggaggtg
gaccccaacatccaggccgtgcgcacccaggagaaggagcagatcaagaccctcaacaac
aagtttgcctccttcatagacaaggtacggttcctggagcagcagaacaagatgctggag
accaagtggagcctcctgcagcagcagaagacggctcgaagcaacatggacaacatgttc
gagagctacatcaacaaccttaggcggcagctggagactctgggccaggagaagctgaag
ctggaggcggagcttggcaacatgcaggggctggtggaggacttcaagaacaagtatgag
gatgagatcaataagcgtacagagatggagaacgaatttgtcctcatcaagaaggatgtg
gatgaagcttacatgaacaaggtagagctggagtctcgcctggaagggctgaccgacgag
atcaacttcctcaggcagctatatgaagaggagatccgggagctgcagtcccagatctcg
gacacatctgtggtgctgtccatggacaacagccgctccctggacatggacagcatcatt
gctgaggtcaaggcacagtacgaggatattgccaaccgcagccgggctgaggctgagagc
atgtaccagatcaagtatgaggagctgcagagcctggctgggaagcacggggatgacctg
cggcgcacaaagactgagatctctgagatgaaccggaacatcagccggctccaggctgag
attgagggcctcaaaggccagagggcttccctggaggccgccattgcagatgccgagcag
cgtggagagctggccattaaggatgccaacgccaagttgtccgagctggaggccgccctg
cagcgggccaagcaggacatggcgcggcagctgcgtgagtaccaggagctgatgaacgtc
aagctggccctggacatcgagatcgccacctacaggaagctgctggagggcgaggagagc
cggctggagtctgggatgcagaacatgagtattcatacgaagaccaccagcggctatgca
ggtggtctgagctcggcctatgggggcctcacaagccccggcctcagctacagcctgggc
tccagctttggctctggcgcgggctccagctccttcagccgcaccagctcctccagggcc
gtggttgtgaagaagatcgagacacgtgatgggaagctggtgtctgagtcctctgacgtc
ctgcccaagtga

DBGET integrated database retrieval system