KEGG   Homo sapiens (human): 3858Help
Entry
3858              CDS       T01001                                 

Gene name
KRT10, BCIE, BIE, CK10, EHK, K10, KPP
Definition
(RefSeq) keratin 10
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00691  Bullous congenital ichthyosiform erythroderma (BCIE)
H00738  Ichthyosis with confetti
H02265  Annular epidermolytic ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3858 (KRT10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3858 (KRT10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3858 (KRT10)
   04147 Exosome [BR:hsa04147]
    3858 (KRT10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3858 (KRT10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3858 (KRT10)
  Exosomal proteins of other body fluids (saliva and urine)
   3858 (KRT10)
  Exosomal proteins of colorectal cancer cells
   3858 (KRT10)
  Exosomal proteins of melanoma cells
   3858 (KRT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 DUF4618 APG6_N DUF4407 DUF1664 DUF1798
Motif
Other DBs
NCBI-GeneID: 3858
NCBI-ProteinID: NP_000412
OMIM: 148080
HGNC: 6413
Ensembl: ENSG00000186395
Vega: OTTHUMG00000133368
Pharos: P13645(Tbio)
UniProt: P13645
Structure
PDB: 

Position
17q21.2
AA seq 584 aa AA seqDB search
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgatacagctcaagcaagcactactcttcctcccgcagtggaggaggagga
ggaggaggaggatgtggaggaggaggaggagtgtcatccctaagaatttctagcagcaaa
ggctcccttggtggaggatttagctcaggggggttcagtggtggctcttttagccgtggg
agctctggtgggggctgctttgggggctcatcaggtggctatggaggattaggaggtttt
ggtggaggtagctttcgtggaagctatggaagtagcagctttggtgggagttatggaggc
agctttggagggggcagtttcggaggtggcagctttggtgggggcagctttggtggaggc
ggctttggtggaggcggctttggaggaggctttggtggtggatttggaggagatggtggc
cttctctctggaaatgaaaaagtaaccatgcagaatctgaatgaccgcctggcttcctac
ttggacaaagttcgggctctggaagaatcaaactatgagctggaaggcaaaatcaaggag
tggtatgaaaagcatggcaactcacatcagggggagcctcgtgactacagcaaatactac
aaaaccatcgatgaccttaaaaatcagattctcaacctaacaactgataatgccaacatc
ctgcttcagatcgacaatgccaggctggcagctgatgacttcaggctgaagtatgagaat
gaggtagctctgcgccagagcgtggaggctgacatcaacggcctgcgtagggtgctggat
gagctgaccctgaccaaggctgacctggagatgcaaattgagagcctgactgaagagctg
gcctatctgaagaagaaccacgaggaggaaatgaaagaccttcgaaatgtgtccactggt
gatgtgaatgtggaaatgaatgctgccccgggtgttgatctgactcaacttctgaataac
atgagaagccaatatgaacaacttgctgaacaaaaccgcaaagatgctgaagcctggttc
aatgaaaagagcaaggaactgactacagaaattgataataacattgaacagatatccagc
tataaatctgagattactgaattgagacgtaatgtacaagctctggagatagaactacag
tcccaactggccttgaaacaatccctggaagcctccttggcagaaacagaaggtcgctac
tgtgtgcagctctcacagattcaggcccagatatccgctctggaagaacagttgcaacag
attcgagctgaaaccgagtgccagaatactgaataccaacaactcctggatattaagatc
cgactggagaatgaaattcaaacctaccgcagcctgctagaaggagagggaagttccgga
ggcggcggacgcggcggcggaagtttcggcggcggctacggcggcggaagctccggcggc
ggaagctccggcggcggccacggcggcggccacggcggcagttccggcggcggctacgga
ggcggaagctccggcggcggaagctccggcggcggctacgggggcggaagctccagcggc
ggccacggcggcagttccagcggcggctacggtggtggcagttccggcggcggcggcggc
ggctacgggggcggcagctccggcggcggcagcagctccggcggcggatacggcggcggc
agctccagcggaggccacaagtcctcctcttccgggtccgtgggcgagtcttcatctaag
ggaccaagatactaa

DBGET integrated database retrieval system