KEGG   Homo sapiens (human): 3861Help
Entry
3861              CDS       T01001                                 

Gene name
KRT14, CK14, EBS3, EBS4, K14, NFJ
Definition
(RefSeq) keratin 14
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Disease
H00584  Epidermolysis bullosa simplex
H00708  Naegeli-Franceschetti-Jadassohn syndrome
H00796  Dermatopathia pigmentosa reticularis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3861 (KRT14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3861 (KRT14)
   04147 Exosome [BR:hsa04147]
    3861 (KRT14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3861 (KRT14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3861 (KRT14)
  Exosomal proteins of other body fluids (saliva and urine)
   3861 (KRT14)
  Exosomal proteins of colorectal cancer cells
   3861 (KRT14)
  Exosomal proteins of melanoma cells
   3861 (KRT14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 TPR_5 DUF885 Bacillus_HBL FlxA
Motif
Other DBs
NCBI-GeneID: 3861
NCBI-ProteinID: NP_000517
OMIM: 148066
HGNC: 6416
Ensembl: ENSG00000186847
Vega: OTTHUMG00000133426
Pharos: P02533(Tbio)
UniProt: P02533
Structure
PDB: 

Position
17q21.2
AA seq 472 aa AA seqDB search
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSG
GACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQ
NLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTAT
VDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIE
SLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK
DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLE
ETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLE
GEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctgcagccgccagttcacctcctccagctccatgaagggctcctgcggcatc
gggggcggcatcgggggcggctccagccgcatctcctccgtcctggccggagggtcctgc
cgcgcccccagcacctacgggggcggcctgtctgtctcatcctcccgcttctcctctggg
ggagcctgcgggctggggggcggctatggcggtggcttcagcagcagcagcagcagcttt
ggtagtggctttgggggaggatatggtggtggccttggtgctggcttgggtggtggcttt
ggtggtggctttgctggtggtgatgggcttctggtgggcagtgagaaggtgaccatgcag
aacctcaatgaccgcctggcctcctacctggacaaggtgcgtgctctggaggaggccaac
gccgacctggaagtgaagatccgtgactggtaccagaggcagcggcctgctgagatcaaa
gactacagtccctacttcaagaccattgaggacctgaggaacaagattctcacagccaca
gtggacaatgccaatgtccttctgcagattgacaatgcccgtctggccgcggatgacttc
cgcaccaagtatgagacagagttgaacctgcgcatgagtgtggaagccgacatcaatggc
ctgcgcagggtgctggacgaactgaccctggccagagctgacctggagatgcagattgag
agcctgaaggaggagctggcctacctgaagaagaaccacgaggaggagatgaatgccctg
agaggccaggtgggtggagatgtcaatgtggagatggacgctgcacctggcgtggacctg
agccgcattctgaacgagatgcgtgaccagtatgagaagatggcagagaagaaccgcaag
gatgccgaggaatggttcttcaccaagacagaggagctgaaccgcgaggtggccaccaac
agcgagctggtgcagagcggcaagagcgagatctcggagctccggcgcaccatgcagaac
ctggagattgagctgcagtcccagctcagcatgaaagcatccctggagaacagcctggag
gagaccaaaggtcgctactgcatgcagctggcccagatccaggagatgattggcagcgtg
gaggagcagctggcccagctccgctgcgagatggagcagcagaaccaggagtacaagatc
ctgctggacgtgaagacgcggctggagcaggagatcgccacctaccgccgcctgctggag
ggcgaggacgcccacctctcctcctcccagttctcctctggatcgcagtcatccagagat
gtgacctcctccagccgccaaatccgcaccaaggtcatggatgtgcacgatggcaaggtg
gtgtccacccacgagcaggtccttcgcaccaagaactga

DBGET integrated database retrieval system