KEGG   Homo sapiens (human): 3866Help
Entry
3866              CDS       T01001                                 

Gene name
KRT15, CK15, K15, K1CO
Definition
(RefSeq) keratin 15
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3866 (KRT15)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3866 (KRT15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3866 (KRT15)
   04147 Exosome [BR:hsa04147]
    3866 (KRT15)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3866 (KRT15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3866 (KRT15)
  Exosomal proteins of other body fluids (saliva and urine)
   3866 (KRT15)
  Exosomal proteins of colorectal cancer cells
   3866 (KRT15)
  Exosomal proteins of melanoma cells
   3866 (KRT15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Atg14 Bacillus_HBL TPR_MLP1_2 DUF4407 DUF4618 SPATA1_C DUF4686 JIP_LZII
Motif
Other DBs
NCBI-GeneID: 3866
NCBI-ProteinID: NP_002266
OMIM: 148030
HGNC: 6421
Ensembl: ENSG00000171346
Vega: OTTHUMG00000133435
Pharos: P19012(Tbio)
UniProt: P19012 B3KVF5
Position
17q21.2
AA seq 456 aa AA seqDB search
MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacatttctgcaaacttcttcctccacctttgggggtggctcaacccgaggg
ggttccctcctggctgggggaggtggctttggtggggggagtctctctgggggaggtgga
agccgaagtatctcagcttcttctgctaggtttgtctcttcagggtcaggaggaggatat
gggggtggcatgagggtctgtggctttggtggaggggctggtagtgttttcggtggaggc
tttggagggggcgttggtgggggttttggtggtggctttggtggtggcgatggtggtctc
ctctctggcaatgagaaaattaccatgcagaacctcaatgaccgcctggcctcctacctg
gacaaggtacgtgccctggaggaggccaatgctgacctggaggtgaagatccatgactgg
taccagaagcagaccccaaccagcccagaatgcgactacagccaatacttcaagaccatt
gaagagctccgggacaagatcatggccaccaccatcgacaactcccgggtcatcctggag
atcgacaatgccaggctggctgcggacgacttcaggctcaagtatgagaatgagctggcc
ctgcgccagggcgttgaggctgacatcaacggcttgcgccgagtcctggatgagctgacc
ctggccaggactgacctggagatgcagatcgagggcctgaatgaggagctagcctacctg
aagaagaaccacgaagaggagatgaaggagttcagcagccagctggccggccaggtcaat
gtggagatggacgcagcaccgggtgtggacctgacccgtgtgctggcagagatgagggag
cagtacgaggccatggcggagaagaaccgccgggatgtcgaggcctggttcttcagcaag
actgaggagctgaacaaagaggtggcctccaacacagaaatgatccagaccagcaagacg
gagatcacagacctgagacgcacgatgcaggagctggagatcgagctgcagtcccagctc
agcatgaaagctgggctggagaactcactggccgagacagagtgccgctatgccacgcag
ctgcagcagatccaggggctcattggtggcctggaggcccagctgagtgagctccgatgc
gagatggaggctcagaaccaggagtacaagatgctgcttgacataaagacacggctggag
caggagatcgctacttaccgcagcctgctcgagggccaggatgccaagatggctggcatt
gccatcagggaagcctcttcaggaggtggtggtagcagcagcaatttccacatcaatgta
gaagagtcagtggatggacaggtggtttcttcccacaagagagaaatctaa

DBGET integrated database retrieval system