KEGG   Homo sapiens (human): 386653Help
Entry
386653            CDS       T01001                                 

Gene name
IL31, IL-31
Definition
(RefSeq) interleukin 31
  KO
K22631  interleukin 31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    386653 (IL31)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    386653 (IL31)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   386653 (IL31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL31
Motif
Other DBs
NCBI-GeneID: 386653
NCBI-ProteinID: NP_001014358
OMIM: 609509
HGNC: 19372
Ensembl: ENSG00000204671
Vega: OTTHUMG00000168916
Pharos: Q6EBC2(Tbio)
UniProt: Q6EBC2
Position
12q24.31
AA seq 164 aa AA seqDB search
MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEK
GVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAP
ETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcactcaggcccctcgacgtctgtgctctttctgttctgctgcctgggaggc
tggctggcctcccacacgttgcccgtccgtttactacgaccaagtgatgatgtacagaaa
atagtcgaggaattacagtccctctcgaagatgcttttgaaagatgtggaggaagagaag
ggcgtgctcgtgtcccagaattacacgctgccgtgtctcagccctgacgcccagccgcca
aacaacatccacagcccagccatccgggcatatctcaagacaatcagacagctagacaac
aaatctgttattgatgagatcatagagcacctcgacaaactcatatttcaagatgcacca
gaaacaaacatttctgtgccaacagacacccatgaatgtaaacgcttcatcctgactatt
tctcaacagttttcagagtgcatggacctcgcactaaaatcattgacctctggagcccaa
caggccaccacttaa

DBGET integrated database retrieval system