KEGG   Homo sapiens (human): 386674
Entry
386674            CDS       T01001                                 

Gene name
KRTAP10-6, KAP10.6, KAP18.6, KRTAP18-6, KRTAP18.6
Definition
(RefSeq) keratin associated protein 10-6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 PMG
Other DBs
NCBI-GeneID: 386674
NCBI-ProteinID: NP_941961
HGNC: 20523
Ensembl: ENSG00000188155
Vega: OTTHUMG00000057634
Pharos: P60371(Tdark)
UniProt: P60371
Position
21q22.3
AA seq 365 aa
MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPV
SRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCC
KPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVS
CVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCV
PTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRS
SSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSG
QKSSC
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccgcgtccaccatgtccgtctgctccagcgacctgagctacggcagccgcgtctgc
cttcctggttcctgtgactcttgctccgactcctggcaggtggacgactgcccagagagc
tgctgtgagcccccctgctgcgccccggccccctgcctgagcctggtctgcaccccagtg
agccgtgtgtccagcccctgctgcccagtgacctgtgagcccagcccctgccaatcaggc
tgcaccagctcctgcacgccctcgtgctgccagcagtctagctgccagctggcttgctgt
gcctcctccccctgccagcaggcctgctgcgtgcccgtctgctgcaagactgtctgctgc
aagcctgtgtgctgtgtgtccgtctgctgtggggattcttcatgctgccagcagtctagc
tgccagtcagcttgctgcacctcctccccctgccagcaggcctgctgtgtgcccgtctgc
tgcaagcctgtctgctctgggatttcctcttcgtgctgccagcagtctagctgtgtgagc
tgtgtgtccagcccctgctgccaggcggtctgtgagcccagcccctgccaatcaggctgc
accagctcctgcacaccctcatgctgccagcagtctagctgccagccaacttgctgcacc
tcctccccctgccagcaggcctgctgcgtgcccgtctgctgcgtgcctgtgtgctgtgtg
cccacctgctctgaggattcctcttcatgctgccagcagtctagctgccagccagcttgc
tgcacctcctccccctgccagcacgcctgctgtgtgcccgtctgctctggggcttccaca
tcatgctgccagcagtctagctgccagccggcttgctgcaccgcctcctgctgcagatcc
tcctcctccgtgtccctcctctgccaccctgtgtgcaagtccacctgctgcgtgcccgtc
ccctcctgtggtgcctctgcctcctcctgccagcccagctgctgccgcacggcctcctgt
gtttccctcctctgccgccccatgtgctcccgccctgcctgctacagcctctgctctggc
cagaagtccagctgctga

DBGET integrated database retrieval system