KEGG   Homo sapiens (human): 386675Help
Entry
386675            CDS       T01001                                 

Gene name
KRTAP10-7, KAP10.7, KAP18.7, KRTAP18-7
Definition
(RefSeq) keratin associated protein 10-7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2
Motif
Other DBs
NCBI-GeneID: 386675
NCBI-ProteinID: NP_941962
HGNC: 22970
Ensembl: ENSG00000272804
Vega: OTTHUMG00000188307
Pharos: P60409(Tdark)
UniProt: P60409
Position
21q22.3
AA seq 370 aa AA seqDB search
MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPV
SYVSSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCC
KPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVS
CVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCKPACCTSSPCQQACCVPVCCKPVCCV
PTCSDDSGSCCQPACCTSSQSQQGCCVPVCCKPVCCVPVCSGASTSCCQQSSCQPACCTT
SCCRPSSSVSLLCRPVCRPACCVPVPSCCAPTSSCQASCCRPASCVSLLCRPACSRPACC
GPTSTQKSSC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtccactatgtctgtctgctccagcgacctgagctacggcagccgcgtctgc
cttcctggttcctgtgactcttgctccgactcctggcaggtggacgactgcccagagagc
tgctgcgagcccccctgctgcgccccggccccctgcctgagcctggtctgcaccccagtg
agctatgtgtccagcccctgctgccgagtgacctgtgagcccagcccctgccaatcaggc
tgcaccagctcctgcacgccctcgtgctgccagcagtctagctgccagctggcttgctgt
gcctcctccccctgccagcaggcctgctgcgtgcccgtctgctgcaagactgtctgctgc
aagcctgtgtactgtgtgcctgtctgcagtggggattcttcatgctgccagcagtctagc
tgccagtcagcttgctgcacctcctccccctgccagcaggcctgctgtgtgcccatctgc
tgcaagcctgtctgctctgggatttcctcttcgtgctgccagcagtctagctgtgtgagc
tgtgtgtccagtccctgctgccaggcggtctgtgagcccagcccctgccaatcaggctgc
atcagctcctgcacgccctcgtgctgccagcagtctagctgcaagccggcttgctgcacc
tcctccccttgccagcaggcctgctgtgtgcctgtctgctgcaagcccgtctgctgtgtg
cccacctgctctgatgattccggttcatgctgccagccagcttgctgcacctcctcccaa
agccagcagggctgctgcgtgcccgtctgctgtaagcctgtgtgctgtgtgcccgtctgc
tctggggcttccacttcatgctgccagcagtctagctgccagccggcttgctgcaccacc
tcctgctgcagaccctcctcctccgtgtccctcctctgccgccccgtgtgcaggcccgcc
tgctgcgtgcccgtcccctcctgctgcgcccccacctcctcctgccaggccagctgctgc
cgcccagcctcctgtgtgtctctcctttgccgccccgcatgctcccgcccggcctgctgt
ggccccacctcaacccagaagtccagctgctga

DBGET integrated database retrieval system