KEGG   Homo sapiens (human): 386676Help
Entry
386676            CDS       T01001                                 

Gene name
KRTAP10-9, KAP10.9, KAP18.9, KRTAP18-9
Definition
(RefSeq) keratin associated protein 10-9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2
Motif
Other DBs
NCBI-GeneID: 386676
NCBI-ProteinID: NP_941963
HGNC: 22971
Ensembl: ENSG00000221837
Vega: OTTHUMG00000057637
UniProt: P60411
Position
21q22.3
AA seq 292 aa AA seqDB search
MAASTMSIRSSAYSDSWQVDDCPESCCEPPCCATSCCAPAPCLTLVCTPVSRVSSPCCQV
TCEPSPCQSGCTSSCTPSCCQQSSCQPAYCTSSPCQQACCVPVCCKPVCCVPVCCGASSC
CQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQQSSCQPACCTSSPCQQ
SYCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVSLLCRPVCR
PACCVPVSSCCAPTSSRQPSYCRQASCVSLLCRPVCSRPACYSFSSGQKSSC
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccaccatgtccatccgctccagcgcttactccgactcctggcaggtggac
gactgcccagagagctgctgtgagcccccctgctgcgccaccagctgctgcgccccggcc
ccctgcctgaccctggtctgcaccccagtgagccgtgtatccagcccctgctgccaggtg
acctgtgagcccagcccctgccaatcaggctgcaccagctcctgcacgccctcgtgctgc
cagcagtctagctgccagccggcttactgcacctcctccccctgccagcaggcctgctgc
gtgcccgtctgctgcaagcctgtgtgctgcgtgcccgtctgctgtggggcttcttcgtgc
tgccaacagtctagctaccagccagcttgctgtgcctcttcctcctgccagccggcctgc
tgtgtgcccgtctgctgcaaacctgtgtgctgtgcgcccacctgctctgaggattcctat
tcatgctgccaacagtctagctgccagccagcttgctgcacttcctccccctgccagcag
tcctactgtgtgcctgtctgctgtaagcctgtctgctgcaaacccatctgctgtgtgcct
gtctgctctggggcttcctctttgtgctgccagcagtctggctgccagccggcttgctgc
accacctcctgctgcagaccctcctcctctgtgtccctcctctgccgccctgtgtgcagg
cccgcctgctgcgtgcccgtctcctcctgctgtgcccccacctcctcccgccagcccagc
tattgccgccaggcctcctgtgtgtcccttctctgccgccctgtgtgctcccgcccggcc
tgctacagcttctcctcaggccagaagtccagctgctga

DBGET integrated database retrieval system