KEGG   Homo sapiens (human): 386677
Entry
386677            CDS       T01001                                 

Gene name
KRTAP10-1, KAP10.1, KAP18-1, KAP18.1, KRTAP10.1, KRTAP18-1, KRTAP18.1
Definition
(RefSeq) keratin associated protein 10-1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 386677
NCBI-ProteinID: NP_941964
HGNC: 22966
Ensembl: ENSG00000215455
Vega: OTTHUMG00000057627
Pharos: P60331(Tdark)
UniProt: P60331
Position
21q22.3
AA seq 282 aa
MAASTMSVCSSACSDSWQVDACPESCCEPHCCALSCCAPAPCLTLVCTPVSRVSSPCCQA
ACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCLPTCSKDSSS
CCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCSEDSSSCCQQSSCHPACCTSSPCQ
QACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVC
RPACCMPVSSCCAPASSCQASCCRPASCVSLLCRPACSRPAC
NT seq 849 nt   +upstreamnt  +downstreamnt
atggccgcgtccaccatgtccgtctgctccagcgcttgctccgactcctggcaggtggat
gcctgcccagagagctgctgtgagccccactgctgcgccctcagctgctgcgccccggcc
ccctgcctgaccctggtctgcaccccagtgagccgtgtgtccagcccctgctgccaggca
gcctgtgagcccagcccctgccaatcaggctgcaccagctcctgcacgccctcgtgctgc
cagcagtctagctgccagccggcttgctgcacctcctccccctgccagcaggcctgctgc
gtgcccgtctgctgcaagcctgtgtgctgcctgcccacctgctctaaggattcctcttca
tgctgccagcagtctagctgccagccaacttgctgtgcctcttcctccagccagcagtcc
tgctgtgtgcctgtttgctgcaagcctgtgtgctatgtgcccacctgctctgaggattcc
tcttcatgctgccagcagtctagctgccatccagcttgctgcacctcctccccctgccag
caggcctgctgcgtgcccgtccgttgcaagcctgtctgctgcaagcccatctgctgtgtg
cccgtctgctctggggcttccacttcatgctgccagcagtctagctgccagccggcttgc
tgcaccacctcctgctgcagaccctcctcctccgtgtccctcctctgccgccctgtatgc
cggcccgcctgctgtatgcctgtctcctcctgctgtgcccctgcctcctcctgccaggcc
agctgctgccgcccggcctcctgcgtgtccctcctctgccgccccgcgtgctcccgcccg
gcctgctga

DBGET integrated database retrieval system