KEGG   Homo sapiens (human): 386678
Entry
386678            CDS       T01001                                 

Gene name
KRTAP10-11, KAP10.11, KAP10.9, KAP18-9, KAP18.11, KRTAP10-9, KRTAP10.9, KRTAP18-11, KRTAP18-9, KRTAP18.11, KRTAP18.9
Definition
(RefSeq) keratin associated protein 10-11
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 386678
NCBI-ProteinID: NP_941965
HGNC: 20528
Ensembl: ENSG00000243489
Vega: OTTHUMG00000057626
Pharos: P60411(Tdark) P60412(Tdark)
UniProt: P60412
Position
21q22.3
AA seq 298 aa
MAASTMSVCSSAYSDSWQVDDCPESCCEPPCSAPSCCAPAPSLSLVCTPVSCVSSPCCQA
ACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKTVCCKPVCCVPVCC
GAASSCCRQSSCQPACCASSSCQPACCVPVCCKPVCCVSTCSEDSSSCCQQSSCQPACCT
SSSYQQACCVPVCCKTVYCKPICCVPVCSRASSSRCQQPSCQPACCTTSCCRPSSSVSLL
CHPVCRSTCCVPVSSCCAPTSSCQSSCCRPASCVSLLCRPASSRLACYSLCSGKKSSC
NT seq 897 nt   +upstreamnt  +downstreamnt
atggccgcgtccaccatgtctgtctgctccagcgcttactccgactcctggcaggtggac
gactgcccagagagctgctgtgagcccccctgcagcgcccccagctgctgcgccccggcc
ccctccctgagcctggtctgcaccccagtgagctgtgtgtccagcccctgctgccaggcg
gcctgtgagcccagcgcctgccaatcaggctgcaccagctcctgcacgccgtcatgctgc
cagcagtctagctgccagccggcttgctgcacctcctccccctgccagcaggcctgctgt
gtgcctgtctgctgcaagactgtctgctgcaagcctgtgtgctgtgtgcctgtctgctgt
ggggctgcttcttcgtgctgccggcagtctagctgccagccagcttgctgtgcctcttcc
tcctgccagccggcctgctgtgtgcccgtctgctgcaagcctgtgtgctgtgtgtccacc
tgctctgaggattcctcttcatgctgccagcagtctagctgccagccagcttgctgcacc
tcctcctcctaccagcaggcctgctgcgtgcctgtctgctgcaagactgtctactgcaag
cccatctgctgtgtgcctgtctgctctagggcttcctcttcacgctgccagcagcctagc
tgccagccagcttgctgcaccacctcctgctgcagaccctcctcctctgtgtccctcctc
tgccaccccgtgtgcaggtccacctgctgtgtgcccgtctcctcctgctgtgcccccacc
tcctcctgccagtccagctgctgccgcccggcctcctgcgtgtccctcctctgccgcccc
gcaagctcccgcctggcctgctacagcctctgctcaggcaagaagtccagctgctga

DBGET integrated database retrieval system