KEGG   Homo sapiens (human): 386681Help
Entry
386681            CDS       T01001                                 

Gene name
KRTAP10-8, KAP10.8, KRTAP18-8, KRTAP18.8
Definition
(RefSeq) keratin associated protein 10-8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 PMG Keratin_B2
Motif
Other DBs
NCBI-GeneID: 386681
NCBI-ProteinID: NP_941968
HGNC: 20525
Ensembl: ENSG00000187766
Vega: OTTHUMG00000057632
Pharos: P60410(Tdark)
UniProt: P60410
Position
21q22.3
AA seq 259 aa AA seqDB search
MADACCTRTYVIAASTMSVCSSDVGHVSRVSSPSTCTGSSWQVDNCQESCCEPRSCASSC
CTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQQACCV
PVCCKSNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVC
SGASSLCCQKSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVPSCCVPASSCQPSCC
HPASCLSFLCRPACSRLAC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcctgctgcaccaggacgtatgtgattgctgcatccaccatgtctgtctgc
tccagtgacgtgggccatgtcagccgagtctcctcccccagcacctgcactggctcctcc
tggcaggtggacaattgccaggaaagctgctgcgagccccgctcctgtgcctccagctgc
tgtacccctagctgctgtgccccagccccctgcctggccctggtctgtgccccagtgagc
tgtgagcccagcccctgccaatcaggctgcaccgactcctgcacaccttcatgctgccag
cagtctagctgccagccggcttgctgcacctcctccccctgccaacaggcctgctgtgtg
cctgtgtgctgcaagtccaactgctgcaagcccgtgtgctgcgtgtccatctgctctgga
gcttcctccccatgctgccagcagtctagctgccagtcagcttgctgcaccttctcccca
tgccaacaggcctgctgtgtgcccatctgctgcaagcccatctgctgtgtgcctgtctgc
tctggggcttcctctctgtgctgccagaagtctagctgccagccggcttgctgcaccacc
tcctgctgcagaccctcctcctccgtgtccctcctctgccgccctgtgtgccggcctgcc
tgctgtgtgcctgtcccctcctgttgtgtccctgcctcctcctgccagcccagctgctgc
cacccggcctcctgcctgtccttcctctgccgccccgcgtgctcccgcctggcctgctga

DBGET integrated database retrieval system