KEGG   Homo sapiens (human): 386682Help
Entry
386682            CDS       T01001                                 

Gene name
KRTAP10-3, KAP10.3, KAP18-3, KAP18.3, KRTAP10.3, KRTAP18-3, KRTAP18.3
Definition
(RefSeq) keratin associated protein 10-3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2
Motif
Other DBs
NCBI-GeneID: 386682
NCBI-ProteinID: NP_941969
HGNC: 22968
Ensembl: ENSG00000212935
Vega: OTTHUMG00000057628
Pharos: P60369(Tdark)
UniProt: P60369
Position
21q22.3
AA seq 221 aa AA seqDB search
MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQA
ACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCC
KPICCVPVCSGASSSCCQQSSRQPACCTTSCCRPSSSVSLLCRPVCRSTCCVPIPSCCAP
ASTCQPSCCRPASCVSLLCRPTCSRLSSACCGLSSGQKSSC
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtctaccatgtccgtctgctccagcgcttactctgactcctggcaggtggac
gcctgcccagagagctgctgtgagcccccctgctgcgccaccagctgctgcgccccggcc
ccctgcctgaccctggtctgcaccccagtgagctgtgtgtccagcccctgctgccaggcg
gcctgtgagcccagcccctgccagtcaggctgcaccagctcctgcacgccctcgtgctgc
cagcagtctagctgccagccagcttgctgcacatcctccccctgccagcaggcctgctgc
gtgcctgtctgctgcaagccagtctgctgtgtgcccgtctgctgcaagcctgtctgctgc
aagcccatctgctgtgtgcccgtctgctctggggcttcctcttcatgctgccagcagtct
agccgccagccggcttgctgcaccacctcctgctgcagaccctcctcctccgtgtccctc
ctctgccgccccgtgtgcaggtccacctgctgtgtgcccatcccctcctgctgtgcccct
gcctccacctgccagcccagctgctgccgcccggcctcctgcgtgtccctcctctgccgc
cccacgtgctcccgcctctcttccgcgtgctgcggcctctcctcaggccagaagtccagc
tgctga

DBGET integrated database retrieval system