KEGG   Homo sapiens (human): 3868
Entry
3868              CDS       T01001                                 

Gene name
KRT16, CK16, FNEPPK, K16, K1CP, KRT16A, NEPPK, PC1
Definition
(RefSeq) keratin 16
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00684  Pachyonychia congenita
H00723  Non-epidermolytic palmoplantar keratoderma
H02263  Focal nonepidermolytic palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3868 (KRT16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3868 (KRT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3868 (KRT16)
   04147 Exosome [BR:hsa04147]
    3868 (KRT16)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3868 (KRT16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3868 (KRT16)
  Exosomal proteins of other body fluids (saliva and urine)
   3868 (KRT16)
  Exosomal proteins of colorectal cancer cells
   3868 (KRT16)
  Exosomal proteins of melanoma cells
   3868 (KRT16)
SSDB
Motif
Pfam: Filament TPR_MLP1_2
Other DBs
NCBI-GeneID: 3868
NCBI-ProteinID: NP_005548
OMIM: 148067
HGNC: 6423
Ensembl: ENSG00000186832
Vega: OTTHUMG00000133495
Pharos: P08779(Tbio)
UniProt: P08779
Position
17q21.2
AA seq 473 aa
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccacctgcagccgccagttcacctcctccagctccatgaagggctcctgcggcatc
ggaggcggcatcgggggcggctccagccgcatctcctccgtcctggccggagggtcctgc
cgtgcccccagcacctacgggggcggcctgtctgtctcctctcgcttctcctctggggga
gcctgcgggctggggggcggctatggcggtggcttcagcagcagcagcagctttggtagt
ggcttcgggggaggatatggtggtggccttggtgctggcttcggtggtggcttgggtgct
ggctttggtggtggttttgctggtggtgatgggcttctggtgggcagtgagaaggtgacc
atgcagaacctcaatgaccgcctggcctcctacctggacaaggtgcgtgctctggaggag
gccaacgccgacctggaagtgaagatccgtgactggtaccagaggcagcggcccagtgag
atcaaagactacagtccctacttcaagaccatcgaggacctgaggaacaagatcattgcg
gccaccattgagaatgcgcagcccattttgcagattgacaatgccaggctggcagccgat
gacttcaggaccaagtatgagcatgaactggccctgcggcagactgtggaggccgacgtc
aatggcctgcgccgggtgttggatgagctgaccctggccaggactgacctggagatgcag
atcgaaggcctgaaggaggagctggcctacctgaggaagaaccacgaggaggagatgctt
gctctgagaggtcagaccggcggagatgtgaacgtggagatggatgctgcacctggcgtg
gacctgagccgcatcctgaatgagatgcgtgaccagtacgagcagatggcagagaaaaac
cgcagagacgctgagacctggttcctgagcaagaccgaggagctgaacaaagaagtggcc
tccaacagcgaactggtacagagcagccgcagtgaggtgacggagctccggagggtgctc
cagggcctggagattgagctgcagtcccagctcagcatgaaagcatccctggagaacagc
ctggaggagaccaaaggccgctactgcatgcagctgtcccagatccagggactgattggc
agtgtggaggagcagctggcccagctacgctgtgagatggagcagcagagccaggagtac
cagatcttgctggatgtgaagacgcggctggagcaggagattgccacctaccgccgcctg
ctggagggcgaggatgcccacctttcctcccagcaagcatctggccaatcctattcttcc
cgcgaggtcttcacctcctcctcgtcctcttcgagccgtcagacccggcccatcctcaag
gagcagagctcatccagcttcagccagggccagagctcctag

DBGET integrated database retrieval system