KEGG   Homo sapiens (human): 387119Help
Entry
387119            CDS       T01001                                 

Gene name
CEP85L, C6orf204, NY-BR-15, bA57K17.2
Definition
(RefSeq) centrosomal protein 85 like
  KO
K16766  centrosomal protein CEP85
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    387119 (CEP85L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    387119 (CEP85L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 387119
NCBI-ProteinID: NP_001035940
HGNC: 21638
Ensembl: ENSG00000111860
Vega: OTTHUMG00000015465
Pharos: Q5SZL2(Tdark)
UniProt: Q5SZL2 Q3ZCQ5
Position
6q22.31
AA seq 805 aa AA seqDB search
MWGRFLAPEASGRDSPGGARSFPAGPDYSSAWLPANESLWQATTVPSNHRNNHIRRHSIA
SDSGDTGIGTSCSDSVEDHSTSSGTLSFKPSQSLITLPTAHVMPSNSSASISKLRESLTP
DGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESR
NGLEKIGKAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKYKFESCSKEDF
RASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVRTQMWL
TEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKW
ESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHYVNCEDSYVASLQP
QYENTSLQTPFSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEEKL
KTRDRYISSLKKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQILEEKNKN
LQEALIDTEKKLEEIKKQCQDKETQLICQKKKEKELVTTVQSLQQKVERCLEDGIRLPML
DAKQLQNENDNLRQQNETASKIIDSQQDEIDRMILEIQSMQGKLSKEKLTTQKMMEELEK
KERNVQRLTKALLENQRQTDETCSLLDQGQEPDQSRQQTVLSKRPLFDLTVIDQLFKEMS
CCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSTETLTKKLSDVCQLR
RDIDELRTTISDRYAQDMGDNCITQ
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggcgcttcctggctccggaggccagcggccgggatagccccggcggagcccgc
agcttccctgccggcccagattattcatcagcatggctacctgctaatgaatcattgtgg
caggccacaactgttccatctaaccatcgaaataaccatatcaggagacacagtatagct
tctgacagtggagacactggcattggaacttcctgttctgatagcgtggaagatcattca
acttcaagtggcacattatcttttaagcctagtcaatcattgattactcttcctactgcc
catgtgatgccgtctaattccagcgcttcaatttccaaacttagggaatcattgacacca
gatggctcaaaatggagtacaagcctcatgcaaacattgggaaaccacagtaggggggag
caggactcttccctagacatgaaggacttccggccacttcggaaatggtcatctttatcc
aaactcactgccccggataactgtggccagggtggcactgtatgcagagaagagtcaagg
aatggtttggagaagatagggaaggctaaggctttaacatcacaactgaggacaattggg
cctagctgtttacatgatagtatggagatgcttaggttagaggacaaggaaataaataaa
aaacggtcatcaactctggactgcaagtataaatttgagagctgtagcaaggaggacttt
agagcctcttcctctactcttaggagacagcctgtagacatgacatatagtgccttacct
gaaagcaagcccattatgacaagctcagaggcttttgaacctccaaaatatttaatgctt
ggtcaacaggcagtaggtggagttcccattcagccttccgtaaggactcagatgtggctt
acagagcagctgcggacaaatcctttggaaggtagaaatacagaggattcttacagttta
gctccttggcaacagcagcaaattgaagactttcgacaaggaagtgaaacaccaatgcag
gttttgactggatcatctcgtcaaagttattcacctggctatcaggatttcagtaagtgg
gaatcaatgttgaaaataaaagaaggacttctaaggcagaaagaaattgtaatcgatcgg
cagaagcaacaaattacccacctgcatgagaggataagggataatgaattacgggctcaa
catgccatgttaggacattatgtaaattgtgaggattcttatgtggctagtttgcagcca
caatatgagaacacttcactccagacaccattttcagaggaatcagtttcccattcccaa
caaggggaatttgagcaaaagcttgcatctactgagaaagaagttttacagcttaatgag
tttctcaaacaaagactaagcctatttagtgaagagaagaagaaactagaggaaaaactt
aaaactagagatcgatacatcagtagtctgaaaaagaaatgccagaaggaatctgaacaa
aacaaagaaaagcagagaagaattgagaccttggaaaagtatctggctgatcttccaact
ctagatgatgtacagagtcagagtctacagctgcagattctggaagaaaaaaataagaat
ttacaagaggctttgatagatacagaaaaaaaacttgaagagatcaaaaagcagtgtcaa
gataaagagacacagttaatatgccagaaaaagaaagaaaaggagttagtaactaccgtt
cagagtttgcaacaaaaagtagaaagatgccttgaagatggaatccgccttcccatgtta
gatgcaaaacagcttcagaatgaaaatgataatctcagacaacaaaatgagactgctagt
aagataatagacagccaacaagatgagattgacagaatgattttagaaattcagtctatg
caaggaaagctttctaaagagaaactgaccactcaaaagatgatggaagagctggaaaag
aaagaaagaaatgtacagagattaacaaaagcattgcttgaaaaccaaagacaaacagat
gagacatgctctttattggatcagggccaggaacctgaccaatctaggcagcagacagtt
ctttccaaacggccactatttgatttgactgtgattgatcagctgttcaaggaaatgtcc
tgttgtttgtttgacttgaaagcattgtgtagtattcttaatcagcgtgctcagggcaag
gagcctaatctttcattattactgggaataagatcaatgaactgttcagctgaagagact
gagaatgaccacagcacagaaacactcactaaaaagctgtcagatgtgtgccagttacga
agagacattgatgaattaaggactacaatatcagaccgctatgctcaggacatgggagac
aactgcattactcagtga

DBGET integrated database retrieval system