KEGG   Homo sapiens (human): 3872
Entry
3872              CDS       T01001                                 
Symbol
KRT17, 39.1, CK-17, K17, PC, PC2, PCHC1
Name
(RefSeq) keratin 17
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00684  Pachyonychia congenita
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3872 (KRT17)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3872 (KRT17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3872 (KRT17)
   04147 Exosome [BR:hsa04147]
    3872 (KRT17)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3872 (KRT17)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3872 (KRT17)
  Exosomal proteins of other body fluids (saliva and urine)
   3872 (KRT17)
  Exosomal proteins of colorectal cancer cells
   3872 (KRT17)
  Exosomal proteins of melanoma cells
   3872 (KRT17)
SSDB
Motif
Pfam: Filament DUF1664
Other DBs
NCBI-GeneID: 3872
NCBI-ProteinID: NP_000413
OMIM: 148069
HGNC: 6427
Ensembl: ENSG00000128422
Pharos: Q04695(Tbio)
UniProt: Q04695 Q14666
Position
17:complement(41619442..41624575)
AA seq 432 aa
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALR
LSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVE
MDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEM
EQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV
ISSREQVHQTTR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaccacctccatccgccagttcacctcctccagctccatcaagggctcctccggcctg
gggggcggctcgtcccgcacctcctgccggctgtctggcggcctgggtgccggctcctgc
aggctgggatctgctggcggcctgggcagcaccctcgggggtagcagctactccagctgc
tacagctttggctctggtggtggctatggcagcagctttgggggtgttgatgggctgctg
gctggaggtgagaaggccaccatgcagaacctcaatgaccgcctggcctcctacctggac
aaggtgcgtgccctggaggaggccaacactgagctggaggtgaagatccgtgactggtac
cagaggcaggccccggggcccgcccgtgactacagccagtactacaggacaattgaggag
ctgcagaacaagatcctcacagccaccgtggacaatgccaacatcctgctacagattgac
aatgcccgtctggctgctgatgacttccgcaccaagtttgagacagagcaggccctgcgc
ctgagtgtggaggccgacatcaatggcctgcgcagggtgctggatgagctgaccctggcc
agagccgacctggagatgcagattgagaacctcaaggaggagctggcctacctgaagaag
aaccacgaggaggagatgaacgccctgcgaggccaggtgggtggtgagatcaatgtggag
atggacgctgccccaggcgtggacctgagccgcatcctcaacgagatgcgtgaccagtat
gagaagatggcagagaagaaccgcaaggatgccgaggattggttcttcagcaagacagag
gaactgaaccgcgaggtggccaccaacagtgagctggtgcagagtggcaagagtgagatc
tcggagctccggcgcaccatgcaggccttggagatagagctgcagtcccagctcagcatg
aaagcatccctggagggcaacctggcggagacagagaaccgctactgcgtgcagctgtcc
cagatccaggggctgattggcagcgtggaggagcagctggcccagcttcgctgcgagatg
gagcagcagaaccaggaatacaaaatcctgctggatgtgaagacgcggctggagcaggag
attgccacctaccgccgcctgctggagggagaggatgcccacctgactcagtacaagaaa
gaaccggtgaccacccgtcaggtgcgtaccattgtggaagaggtccaggatggcaaggtc
atctcctcccgcgagcaggtccaccagaccacccgctga

DBGET integrated database retrieval system