KEGG   Homo sapiens (human): 387263
Entry
387263            CDS       T01001                                 

Gene name
C6orf120
Definition
(RefSeq) chromosome 6 open reading frame 120
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPF0669
Other DBs
NCBI-GeneID: 387263
NCBI-ProteinID: NP_001025034
OMIM: 616987
HGNC: 21247
Ensembl: ENSG00000185127
Vega: OTTHUMG00000016057
Pharos: Q7Z4R8(Tdark)
UniProt: Q7Z4R8
Position
6q27
AA seq 191 aa
MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLN
HEGKIVLRMRSLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYG
HPSHLESEFEMKVYYDGTVEQHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILI
SILKLVLEILF
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccgctccccgcgggagggccgcgccctggacgacggccctgctgctgctcctagcc
tcgcaggtcctgtctccgggaagctgcgcggacgaggaggaggtccccgaggagtgggtg
ctcctgcacgtcgtccagggccagataggcgccgggaactacagctacctgcggctgaac
cacgagggcaagatagtcctcaggatgcgcagcctcaagggagatgcggatctgtacgtc
tccgccagcagcctgcaccccagcttcgacgactacgagctgcaatcggccacctgcggc
ccggacgccgtgtccatccccgcgcacttccggcgcccagtgggcatcggcgtctatgga
cacccctcccacctggagagcgagttcgagatgaaggtgtactacgacggcacggtcgag
cagcacccgttcggcgaggccgcctaccccgccgacggcgcagatgccggccagaagcac
gctggtgccccggaagacgcctcgcaagaggaggaatctgttctctggacgatattaatt
agcattttgaaactggtacttgaaattctcttttga

DBGET integrated database retrieval system