KEGG   Homo sapiens (human): 387332Help
Entry
387332            CDS       T01001                                 

Gene name
TBPL2, TBP2, TRF3
Definition
(RefSeq) TATA-box binding protein like 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05016  Huntington's disease
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    387332 (TBPL2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    387332 (TBPL2)
  Neurodegenerative diseases
   05016 Huntington's disease
    387332 (TBPL2)
  Infectious diseases
   05166 HTLV-I infection
    387332 (TBPL2)
   05168 Herpes simplex infection
    387332 (TBPL2)
   05169 Epstein-Barr virus infection
    387332 (TBPL2)
   05165 Human papillomavirus infection
    387332 (TBPL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    387332 (TBPL2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     387332 (TBPL2)
  RNA polymerase III system
    TFIIIB
     387332 (TBPL2)
  RNA polymerase I system
    SL1/TIF-1B
     387332 (TBPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBP DUF3378
Motif
Other DBs
NCBI-GeneID: 387332
NCBI-ProteinID: NP_950248
OMIM: 608964
HGNC: 19841
Ensembl: ENSG00000182521
Vega: OTTHUMG00000140313
Pharos: Q6SJ96(Tbio)
UniProt: Q6SJ96
Position
14q22.3
AA seq 375 aa AA seqDB search
MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPL
FSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHE
TEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSL
ASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMR
IREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCD
VRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYE
AFENIYPILKGFKKA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgcgccctggccggagcgggttccgaggctgctcgctccgcgcttaccctct
tacccgcccccacccccaacagtgggattacggtccatggagcaggaggagacctacctg
gagctctacctggaccagtgcgccgctcaggatggccttgccccacccaggtctcccctg
ttcagcccagttgtaccttatgatatgtacatactgaatgcatccaatccggatactgca
tttaattcgaaccctgaagtcaaagaaacatctggtgatttctcatctgtggatcttagc
ttcctaccagatgaagttacccaggaaaataaagaccagcctgtcattagcaaacacgaa
actgaagaaaattctgaaagccaaagtccacaaagtaggttgccatcacccagcgaacag
gacgttgggctgggcttaaacagcagcagtttgtcaaattcccattcacagctgcaccct
ggtgatactgactcagtccagccctctcctgagaaaccaaactccgactccttgtctctg
gcatccataactcccatgacaccaatgacccctatttcagaatgttgtggaattgtacct
caactacagaatatagtttccactgtaaacctggcctgtaagttggatctgaagaaaata
gctttgcatgcaaaaaatgcagaatataacccaaagaggtttgctgctgtcataatgagg
atccgagagcccaggacaacagcccttatatttagctctgggaagatggtctgcacggga
gccaaaagtgaagagcagtctcgacttgcagcaagaaaatatgctcgtgtggtgcagaag
cttgggttccctgccagattcctcgattttaaaattcagaacatggttggaagctgtgat
gtgagatttcccatcaggctggaaggtttggtgctaacccatcagcagttcagtagttac
gagcctgaactgtttcctggtcttatttatagaatggtaaaaccacgaattgtgttgctt
atctttgtatctggaaaagttgtgttgacaggtgccaaagaacgttctgagatctatgaa
gcatttgaaaacatctatcctattctaaaaggttttaaaaaagcctga

DBGET integrated database retrieval system