KEGG   Homo sapiens (human): 3875Help
Entry
3875              CDS       T01001                                 

Gene name
KRT18, CK-18, CYK18, K18
Definition
(RefSeq) keratin 18
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05130  Pathogenic Escherichia coli infection
Disease
H02225  Familial cirrhosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3875 (KRT18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3875 (KRT18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3875 (KRT18)
   04147 Exosome [BR:hsa04147]
    3875 (KRT18)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3875 (KRT18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3875 (KRT18)
  Exosomal proteins of other body fluids (saliva and urine)
   3875 (KRT18)
  Exosomal proteins of colorectal cancer cells
   3875 (KRT18)
  Exosomal proteins of melanoma cells
   3875 (KRT18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Spc7 TPR_MLP1_2 Nsp1_C DUF2721 T2SSM_b
Motif
Other DBs
NCBI-GeneID: 3875
NCBI-ProteinID: NP_000215
OMIM: 148070
HGNC: 6430
Ensembl: ENSG00000111057
Vega: OTTHUMG00000169882
Pharos: P05783(Tbio)
UniProt: P05783 A0A024RAY2
Position
12q13.13
AA seq 430 aa AA seqDB search
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccactcgctccaccttctccaccaactaccggtccctgggctctgtccag
gcgcccagctacggcgcccggccggtcagcagcgcggccagcgtctatgcaggcgctggg
ggctctggttcccggatctccgtgtcccgctccaccagcttcaggggcggcatggggtcc
gggggcctggccaccgggatagccgggggtctggcaggaatgggaggcatccagaacgag
aaggagaccatgcaaagcctgaacgaccgcctggcctcttacctggacagagtgaggagc
ctggagaccgagaaccggaggctggagagcaaaatccgggagcacttggagaagaaggga
ccccaggtcagagactggagccattacttcaagatcatcgaggacctgagggctcagatc
ttcgcaaatactgtggacaatgcccgcatcgttctgcagattgacaatgcccgtcttgct
gctgatgactttagagtcaagtatgagacagagctggccatgcgccagtctgtggagaac
gacatccatgggctccgcaaggtcattgatgacaccaatatcacacgactgcagctggag
acagagatcgaggctctcaaggaggagctgctcttcatgaagaagaaccacgaagaggaa
gtaaaaggcctacaagcccagattgccagctctgggttgaccgtggaggtagatgccccc
aaatctcaggacctcgccaagatcatggcagacatccgggcccaatatgacgagctggct
cggaagaaccgagaggagctagacaagtactggtctcagcagattgaggagagcaccaca
gtggtcaccacacagtctgctgaggttggagctgctgagacgacgctcacagagctgaga
cgtacagtccagtccttggagatcgacctggactccatgagaaatctgaaggccagcttg
gagaacagcctgagggaggtggaggcccgctacgccctacagatggagcagctcaacggg
atcctgctgcaccttgagtcagagctggcacagacccgggcagagggacagcgccaggcc
caggagtatgaggccctgctgaacatcaaggtcaagctggaggctgagatcgccacctac
cgccgcctgctggaagatggcgaggactttaatcttggtgatgccttggacagcagcaac
tccatgcaaaccatccaaaagaccaccacccgccggatagtggatggcaaagtggtgtct
gagaccaatgacaccaaagttctgaggcattaa

DBGET integrated database retrieval system