KEGG   Homo sapiens (human): 387521
Entry
387521            CDS       T01001                                 

Gene name
PEDS1, CarF, KUA, TMEM189
Definition
(RefSeq) plasmanylethanolamine desaturase 1
  KO
K20656  plasmanylethanolamine desaturase [EC:1.14.19.77]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    387521 (PEDS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    387521 (PEDS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.77  plasmanylethanolamine desaturase
     387521 (PEDS1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    387521 (PEDS1)
SSDB
Motif
Pfam: TMEM189_B_dmain MARVEL
Other DBs
NCBI-GeneID: 387521
NCBI-ProteinID: NP_954580
OMIM: 610994
HGNC: 16735
Ensembl: ENSG00000240849
Vega: OTTHUMG00000152625
UniProt: A5PLL7
Position
20q13.13
AA seq 270 aa
MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHN
LVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREH
HIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGT
FTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKI
GFWRRLEDLIQGLTGEKPRADDMKWAQKIK
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcgggcgccgagaactggccgggccagcagctggagctggacgaggacgaggcgtct
tgttgccgctggggcgcgcagcacgccggggcccgcgagctggctgcgctctactcgcca
ggcaagcgcctccaggagtggtgctctgtgatcctgtgcttcagcctcatcgcccacaac
ctggtccatctcctgctgctggcccgctgggaggacacacccctcgtcatactcggtgtt
gttgcaggggctctcattgctgacttcttgtctggcctggtacactggggtgctgacaca
tggggctctgtggagctgcccattgtggggaaggctttcatccgacccttccgggagcac
cacattgacccgacagctatcacacggcacgacttcatcgagaccaacggggacaactgc
ctggtgacactgctgccgctgctaaacatggcctacaagttccgcacccacagccctgaa
gccctggagcagctatacccctgggagtgcttcgtcttctgcctgatcatcttcggcacc
ttcaccaaccagatccacaagtggtcgcacacgtactttgggctgccacgctgggtcacc
ctcctgcaggactggcatgtcatcctgccacgtaaacaccatcgcatccaccacgtctca
ccccacgagacctacttctgcatcaccacaggctggctcaactaccctctggagaagata
ggcttctggcgacgcctggaggacctcatccagggcctgacgggcgagaagcctcgggca
gatgacatgaaatgggcccagaagatcaaataa

DBGET integrated database retrieval system