KEGG   Homo sapiens (human): 387522Help
Entry
387522            CDS       T01001                                 

Gene name
TMEM189-UBE2V1, CROC-1B, CROC1B, KUA-UEV
Definition
(RefSeq) TMEM189-UBE2V1 readthrough
  KO
K20656  transmembrane protein 189
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    387522 (TMEM189-UBE2V1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    387522 (TMEM189-UBE2V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM189_B_dmain UQ_con RWD
Motif
Other DBs
NCBI-GeneID: 387522
NCBI-ProteinID: NP_954673
HGNC: 33521
Ensembl: ENSG00000124208
Vega: OTTHUMG00000033085
Pharos: A5PLL7(Tdark)
UniProt: A5PLL7 Q13404
Structure
PDB: 

Position
20q13.13
AA seq 370 aa AA seqDB search
MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHN
LVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREH
HIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGT
FTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGVKVPRNFRL
LEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPE
APPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLP
QPPEGQCYSN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgaggactggccgggccagcagctggagctggacgaggacgaggcgtct
tgttgccgctggggcgcgcagcacgccggggcccgcgagctggctgcgctctactcgcca
ggcaagcgcctccaggagtggtgctctgtgatcctgtgcttcagcctcatcgcccacaac
ctggtccatctcctgctgctggcccgctgggaggacacacccctcgtcatactcggtgtt
gttgcaggggctctcattgctgacttcttgtctggcctggtacactggggtgctgacaca
tggggctctgtggagctgcccattgtggggaaggctttcatccgacccttccgggagcac
cacattgacccgacagctatcacacggcacgacttcatcgagaccaacggggacaactgc
ctggtgacactgctgccgctgctaaacatggcctacaagttccgcacccacagccctgaa
gccctggagcagctatacccctgggagtgcttcgtcttctgcctgatcatcttcggcacc
ttcaccaaccagatccacaagtggtcgcacacgtactttgggctgccacgctgggtcacc
ctcctgcaggactggcatgtcatcctgccacgtaaacaccatcgcatccaccacgtctca
ccccacgagacctacttctgcatcaccacaggagtaaaagtccctcgcaatttccgactg
ttggaagaactcgaagaaggccagaaaggagtaggagatggcacagttagctggggtcta
gaagatgacgaagacatgacacttacaagatggacagggatgataattgggcctccaaga
acaatttatgaaaaccgaatatacagccttaaaatagaatgtggacctaaatacccagaa
gcacccccctttgtaagatttgtaacaaaaattaatatgaatggagtaaatagttctaat
ggagtggtggacccaagagccatatcagtgctagcaaaatggcagaattcatatagcatc
aaagttgtcctgcaagagcttcggcgcctaatgatgtctaaagaaaatatgaaactccct
cagccgcccgaaggacagtgttacagcaattaa

DBGET integrated database retrieval system