KEGG   Homo sapiens (human): 387522
Entry
387522            CDS       T01001                                 
Symbol
PEDS1-UBE2V1, CROC-1B, CROC1B, KUA-UEV, TMEM189-UBE2V1
Name
(RefSeq) PEDS1-UBE2V1 readthrough
  KO
K20656  plasmanylethanolamine desaturase [EC:1.14.19.77]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    387522 (PEDS1-UBE2V1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    387522 (PEDS1-UBE2V1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.77  plasmanylethanolamine desaturase
     387522 (PEDS1-UBE2V1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    387522 (PEDS1-UBE2V1)
SSDB
Motif
Pfam: Lipid_desat UQ_con RWD
Other DBs
NCBI-GeneID: 387522
NCBI-ProteinID: NP_954673
HGNC: 33521
Ensembl: ENSG00000124208
Pharos: A5PLL7(Tdark)
UniProt: A5PLL7 Q13404
Structure
Position
20:complement(50081124..50153723)
AA seq 370 aa
MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHN
LVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREH
HIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGT
FTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGVKVPRNFRL
LEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPE
APPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLP
QPPEGQCYSN
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcgggcgccgagaactggccgggccagcagctggagctggacgaggacgaggcgtct
tgttgccgctggggcgcgcagcacgccggggcccgcgagctggctgcgctctactcgcca
ggcaagcgcctccaggagtggtgctctgtgatcctgtgcttcagcctcatcgcccacaac
ctggtccatctcctgctgctggcccgctgggaggacacacccctcgtcatactcggtgtt
gttgcaggggctctcattgctgacttcttgtctggcctggtacactggggtgctgacaca
tggggctctgtggagctgcccattgtggggaaggctttcatccgacccttccgggagcac
cacattgacccgacagctatcacacggcacgacttcatcgagaccaacggggacaactgc
ctggtgacactgctgccgctgctaaacatggcctacaagttccgcacccacagccctgaa
gccctggagcagctatacccctgggagtgcttcgtcttctgcctgatcatcttcggcacc
ttcaccaaccagatccacaagtggtcgcacacgtactttgggctgccacgctgggtcacc
ctcctgcaggactggcatgtcatcctgccacgtaaacaccatcgcatccaccacgtctca
ccccacgagacctacttctgcatcaccacaggagtaaaagtccctcgcaatttccgactg
ttggaagaactcgaagaaggccagaaaggagtaggagatggcacagttagctggggtcta
gaagatgacgaagacatgacacttacaagatggacagggatgataattgggcctccaaga
acaatttatgaaaaccgaatatacagccttaaaatagaatgtggacctaaatacccagaa
gcacccccctttgtaagatttgtaacaaaaattaatatgaatggagtaaatagttctaat
ggagtggtggacccaagagccatatcagtgctagcaaaatggcagaattcatatagcatc
aaagttgtcctgcaagagcttcggcgcctaatgatgtctaaagaaaatatgaaactccct
cagccgcccgaaggacagtgttacagcaattaa

DBGET integrated database retrieval system