KEGG   Homo sapiens (human): 387601
Entry
387601            CDS       T01001                                 
Symbol
SLC22A25, HIMTP, UST6
Name
(RefSeq) solute carrier family 22 member 25
  KO
K08206  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 9/10/19/24/25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    387601 (SLC22A25)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   387601 (SLC22A25)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    387601 (SLC22A25)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 387601
NCBI-ProteinID: NP_955384
OMIM: 610792
HGNC: 32935
Ensembl: ENSG00000196600
Pharos: Q6T423(Tdark)
UniProt: Q6T423
Position
11:complement(63158437..63243599)
AA seq 547 aa
MAFQDLLDQVGGLGRFQILQMVFLIMFNVIVYHQTQLENFAAFILDHRCWVHILDNDTIP
DNDPGTLSQDALLRISIPFDSNLRPEKCRRFVHPQWKLIHLNGTFPNTSEPDTEPCVDGW
VYDQSSFPSTIVTKWDLVCESQPLNSVAKFLFMAGMMVGGNLYGHLSDRFGRKFVLRWSY
LQLAIVGTCAAFAPTILVYCSLRFLAGAATFSIIVNTVLLIVEWITHQFCAMALTLTLCA
ASIGHITLGSLAFVIRDQCILQLVMSAPCFVFFLFSRWLAESARWLIINNKPEEGLKELR
KAAHRNGMKNAEDILTMEVLKSTMKQELEAAQKKHSLCELLRIPNICKRICFLSFVRFAS
TIPFWGLTLHLQHLGNNVFLLQTLFGAVTLLANCVAPWALNHMSRRLSQMLLMFLLATCL
LAIIFVPQEMQTLRVVLATLGVGAASLGITCSTAQENELIPSIIRGRATGITGNFANIGG
ALASLMMILSIYSRPLPWIIYGVFAILSGLVVLLLPETRNQPLLDSIQDVENEGVNSLAA
PQRSSVL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcctttcaggacctcctagatcaagttggaggcctggggagattccagatccttcag
atggttttccttataatgttcaacgtcatagtataccatcaaactcagctggagaacttc
gcagcattcatacttgatcatcgctgctgggttcatatactggacaatgacactatccct
gacaatgaccctgggaccctcagccaggatgccctcctgagaatctccatcccattcgac
tcaaatctgaggccagagaagtgtcgtcgctttgtccatccccagtggaagctcattcat
ctgaatgggaccttccccaacacgagtgagccagatacagagccctgtgtggatggctgg
gtatatgaccaaagctccttcccttccaccattgtgactaagtgggatctggtatgcgaa
tctcaaccactgaattcagtagctaaatttctattcatggctggaatgatggtgggaggc
aacctatatggccatttgtcagacaggtttgggagaaagttcgtgctcagatggtcttac
ctccagctcgccattgtaggcacctgtgcggcctttgctcccaccatcctcgtatactgc
tccctgcgcttcttggctggggctgctacatttagcatcattgtaaatactgttttgtta
attgtagagtggataactcaccaattctgtgccatggcattgacattgacactttgtgct
gctagtattggacatataaccctgggaagcctggcttttgtcattcgagaccagtgcatc
ctccagttggtgatgtctgcaccatgctttgtcttctttctgttctcaaggtggctggca
gagtctgctcggtggctcattatcaacaacaaaccagaagagggcttaaaggaacttaga
aaagctgcacacaggaatggaatgaagaatgctgaagacatcctaaccatggaggttttg
aaatccaccatgaagcaagaactggaggcagcacagaaaaagcattctctttgtgaattg
ctccgcatacccaacatatgtaaaagaatctgtttcctgtcctttgtgagatttgcaagt
accatccctttttggggccttactttgcacctccagcatctgggaaacaatgttttcctg
ttgcagactctctttggtgcagtcaccctcctggccaattgtgttgcaccttgggcactg
aatcacatgagccgtcgactaagccagatgcttctcatgttcctactggcaacctgcctt
ctggccatcatatttgtgcctcaagaaatgcagaccctgcgtgtggttttggcaaccctg
ggtgtgggagctgcttctcttggcattacctgttctactgcccaagaaaatgaactaatt
ccttccataatcaggggaagagctactggaatcactggaaactttgctaatattggggga
gccctggcttccctcatgatgatcctaagcatatattctcgacccctgccctggatcatc
tatggagtctttgccatcctctctggccttgttgtcctcctccttcctgaaaccaggaac
cagcctcttcttgacagcatccaggatgtggaaaatgagggagtaaatagcctagctgcc
cctcagaggagctctgtgctatag

DBGET integrated database retrieval system