KEGG   Homo sapiens (human): 387763
Entry
387763            CDS       T01001                                 
Symbol
C11orf96, AG2
Name
(RefSeq) chromosome 11 open reading frame 96
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4695
Other DBs
NCBI-GeneID: 387763
NCBI-ProteinID: NP_001138505
HGNC: 38675
Ensembl: ENSG00000187479
Pharos: Q7Z7L8(Tdark)
UniProt: Q7Z7L8 A0A087WW59
Position
11:43942637..43943878
AA seq 122 aa
MAAKPGELMGICSSYQAVMPHFVCLADEFPQPVRPAKLPKGRGRLRRPRQSRFKTQPVTF
DEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSSDSDS
AL
NT seq 369 nt   +upstreamnt  +downstreamnt
atggccgccaagcccggcgagctgatgggcatctgctccagttaccaggcggtgatgccg
cacttcgtgtgcctggccgacgagttcccgcagcccgtgcggcccgccaagctgcccaag
ggccggggccggctgcggcggccgcgccagtctcgcttcaagacgcagccggtgaccttc
gacgagatccaggaggtggaggaggagggggtgtcccccatggaggaggagaaggccaag
aagtcgttcctgcagagcctggagtgcctgcgccgcagcacgcagagcctgtcgctgcag
cgggagcagctcagcagctgcaaactgaggaacagcctggactccagcgactccgactcg
gccctgtaa

DBGET integrated database retrieval system