KEGG   Homo sapiens (human): 387775
Entry
387775            CDS       T01001                                 
Symbol
SLC22A10, OAT5, hOAT5
Name
(RefSeq) solute carrier family 22 member 10
  KO
K08206  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 9/10/19/24/25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    387775 (SLC22A10)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   387775 (SLC22A10)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    387775 (SLC22A10)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF6500
Other DBs
NCBI-GeneID: 387775
NCBI-ProteinID: NP_001034841
OMIM: 607580
HGNC: 18057
Ensembl: ENSG00000184999
Vega: OTTHUMG00000165197
Pharos: Q63ZE4(Tdark)
UniProt: Q63ZE4
Position
11:63289903..63363144
AA seq 541 aa
MAFEELLSQVGGLGRFQMLHLVFILPSLMLLIPHILLENFAAAIPGHRCWVHMLDNNTGS
GNETGILSEDALLRISIPLDSNLRPEKCRRFVHPQWQLLHLNGTIHSTSEADTEPCVDGW
VYDQSYFPSTIVTKWDLVCDYQSLKSVVQFLLLTGMLVGGIIGGHVSDRFGRRFILRWCL
LQLAITDTCAAFAPTFPVYCVLRFLAGFSSMIIISNNSLPITEWIRPNSKALVVILSSGA
LSIGQIILGGLAYVFRDWQTLHVVASVPFFVFFLLSRWLVESARWLIITNKLDEGLKALR
KVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKRICILVFLRFAN
TIPFYGTMVNLQHVGSNIFLLQVLYGAVALIVRCLALLTLNHMGRRISQILFMFLVGLSI
LANTFVPKEMQTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGA
ALAPLLMTLTVFFTTLPWIIYGIFPIIGGLIVFLLPETKNLPLPDTIKDVENQKKNLKEK
A
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcctttgaggagctcttgagtcaagttggaggccttgggagatttcagatgcttcat
ctggtttttattcttccctctctcatgttattaatccctcatatactgctagagaacttt
gctgcagccattcctggtcatcgttgctgggtccacatgctggacaataatactggatct
ggtaatgaaactggaatcctcagtgaagatgccctcttgagaatctctatcccactagac
tcaaatctgaggccagagaagtgtcgtcgctttgtccatccccagtggcagcttcttcac
ctgaatgggactatccacagcacaagtgaggcagacacagaaccctgtgtggatggctgg
gtatatgatcaaagctacttcccttcgaccattgtgactaagtgggacctggtatgtgat
tatcagtcactgaaatcagtggttcaattcctacttctgactggaatgctggtgggaggc
atcataggtggccatgtctcagacaggtttgggcgaagatttattctcagatggtgtttg
ctccagcttgccattactgacacctgcgctgccttcgctcccaccttccctgtttactgt
gtactacgcttcttggcaggtttttcttccatgatcattatatcaaataattctttgccc
attactgagtggataaggcccaactctaaagccctggtagtaatattgtcatctggtgcc
cttagtattggacagataatcctgggaggcttggcttatgtcttccgagactggcaaacc
ctgcacgtggtggcgtctgtacctttctttgtcttctttcttctttcaaggtggctggtg
gaatctgctcggtggttgataatcaccaataaactagatgagggcttaaaggcacttaga
aaagttgcacgcacaaatggaataaagaatgctgaagaaaccctgaacatagaggttgta
agatccaccatgcaggaggagctggatgcagcacagaccaaaactactgtgtgtgacttg
ttccgcaaccccagtatgcgtaaaaggatctgtatcctggtatttttgagatttgcaaac
acaatacctttttatggtaccatggtcaatcttcagcatgtggggagcaacattttcctg
ttgcaggtactttatggagctgtcgctctcatagttcgatgtcttgctcttttgacacta
aatcatatgggccgtcgaataagccagatattgttcatgttcctggtgggcctttccatt
ttggccaacacgtttgtgcccaaagaaatgcagaccctgcgtgtggctttggcatgtctg
ggaatcggctgttctgctgctactttttccagtgttgctgttcacttcattgaactcatc
cccactgttctcagggcaagagcttcaggaatagatttaacggctagtaggattggagca
gcactggctcccctcttgatgaccttaacggtattttttaccactttgccatggatcatt
tatggaatcttccccatcattggtggccttattgtcttcctcctaccagaaaccaagaat
ctgcctttgcctgacaccatcaaggatgtggaaaatcaaaaaaaaaatctcaaggaaaag
gcataa

DBGET integrated database retrieval system