KEGG   Homo sapiens (human): 387787Help
Entry
387787            CDS       T01001                                 

Gene name
LIPT2
Definition
(RefSeq) lipoyl(octanoyl) transferase 2
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00785  Lipoic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    387787 (LIPT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     387787 (LIPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 387787
NCBI-ProteinID: NP_001138341
OMIM: 617659
HGNC: 37216
Ensembl: ENSG00000175536
Vega: OTTHUMG00000165646
Pharos: A6NK58(Tdark)
UniProt: A6NK58
Position
11q13.4
AA seq 231 aa AA seqDB search
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLE
ACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaacccgccgttcggttggtgcgcctgggtcgggtgccgtacgccgagctactg
gggctgcaggaccgctggctgcggcggctgcaggccgagccaggcattgaggccccgtcg
gggactgaggcgggcgcgctcctgctctgcgagcccgcggggcccgtgtatacggccggg
ctgcgcggcggcctgacgcccgaggaaactgcgcggctacgggccttgggcgccgaggtg
cgcgtcacaggccgcggtggcctggccaccttccacggcccgggccagctgctttgccac
ccggtactcgacctgcggcgtctcggcctgcgcttgcgcatgcacgtagcgtcgctggag
gcgtgcgccgtgcgcctgtgcgagctccagggcctgcaggacgcccgcgcgcggcccccg
ccctacactggcgtctggctagacgatcgcaagatctgcgcgatcggagtccgctgtgga
aggcacatcacatcccacggcctggctctcaactgctctaccgacctcacgtggtttgag
cacatcgtgccctgtggactggttgggacaggcgtcacttccttgagtaaggagctccag
aggcacgtcaccgtggaagaagtaatgccacctttccttgtggcctttaaggagatctac
aagtgcacactgatctcagaggacagccccaactga

DBGET integrated database retrieval system