KEGG   Homo sapiens (human): 387882
Entry
387882            CDS       T01001                                 
Symbol
C12orf75, AGD3, OCC-1, OCC1
Name
(RefSeq) chromosome 12 open reading frame 75
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OCC1
Other DBs
NCBI-GeneID: 387882
NCBI-ProteinID: NP_001138671
HGNC: 35164
Ensembl: ENSG00000235162
Pharos: Q8TAD7(Tbio)
UniProt: Q8TAD7
Position
12:105330691..105371518
AA seq 63 aa
MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTV
RKN
NT seq 192 nt   +upstreamnt  +downstreamnt
atgggctgcgggaactccaccgccaccagcgcgggcgcgggccaaggccctgcaggagca
gccaaagatgtaacagaagaatccgtaacagaagatgacaagaggagaaactatggagga
gtatatgttggcctaccatctgaagctgtcaatatggtgtccagtcaaacaaagacggtt
cggaaaaattag

DBGET integrated database retrieval system