KEGG   Homo sapiens (human): 388
Entry
388               CDS       T01001                                 

Gene name
RHOB, ARH6, ARHB, MST081, MSTP081, RHOH6
Definition
(RefSeq) ras homolog family member B
  KO
K07856  Ras homolog gene family, member B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    388 (RHOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    388 (RHOB)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    388 (RHOB)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 388
NCBI-ProteinID: NP_004031
OMIM: 165370
HGNC: 668
Ensembl: ENSG00000143878
Vega: OTTHUMG00000090755
Pharos: P62745(Tbio)
UniProt: P62745
Structure
PDB: 
6HXU 6SGE 2FV8

Position
2p24.1
AA seq 196 aa
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ
KRYGSQNGCINCCKVL
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcggccatccgcaagaagctggtggtggtgggcgacggcgcgtgtggcaagacgtgc
ctgctgatcgtgttcagtaaggacgagttccccgaggtgtacgtgcccaccgtcttcgag
aactatgtggccgacattgaggtggacggcaagcaggtggagctggcgctgtgggacacg
gcgggccaggaggactacgaccgcctgcggccgctctcctacccggacaccgacgtcatt
ctcatgtgcttctcggtggacagcccggactcgctggagaacatccccgagaagtgggtc
cccgaggtgaagcacttctgtcccaatgtgcccatcatcctggtggccaacaaaaaagac
ctgcgcagcgacgagcatgtccgcacagagctggcccgcatgaagcaggaacccgtgcgc
acggatgacggccgcgccatggccgtgcgcatccaagcctacgactacctcgagtgctct
gccaagaccaaggaaggcgtgcgcgaggtcttcgagacggccacgcgcgccgcgctgcag
aagcgctacggctcccagaacggctgcatcaactgctgcaaggtgctatga

DBGET integrated database retrieval system