KEGG   Homo sapiens (human): 388125Help
Entry
388125            CDS       T01001                                 

Gene name
C2CD4B, FAM148B, NLF2
Definition
(RefSeq) C2 calcium dependent domain containing 4B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 388125
NCBI-ProteinID: NP_001007596
OMIM: 610344
HGNC: 33628
Ensembl: ENSG00000205502
Vega: OTTHUMG00000171959
Pharos: A6NLJ0(Tdark)
UniProt: A6NLJ0
Position
15q22.2
AA seq 364 aa AA seqDB search
MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAA
ESDLWPRAADEDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGP
PAPRPRAHSCGGGGGPDAPLGTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVP
DGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLPERLEAK
GTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAPGPRAVRCRLSLVLRPPGTAR
WQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRLLGQGELSLGA
LLLL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcctcgagaaactctgttcctcggccgcaggcagctccgcgccgaagcccgcc
ttcgccaaagtgctcacgccgaatcgcatccccgaattctgcatcccgccgcggctgccg
gccccttgcacgctcgagtctccaatccgggccgccgccgtgccccggcgctgcgccgct
gaaagcgacctgtggccccgcgcggcagacgaggacgccggccgcacggactgggacccg
cgctcgcaggcagcgctgtcactgccgcacctgccccgtgtgcgcaccacctacggcttc
tgcgcgctgctcgagagcccgcacacgcgccgcaaggagtcgctcctgctcgggggcccg
cccgcgccccggccccgggcccacagctgcggcggcggcggaggcccggacgcccccctg
gggaccctgtgcggcccgcgaggtccgggcccggccacccccgcggcccccggcggtccc
cgcctgccccaggacgcgctcgctgcggggccccgccgctgccgcctcctgcgcgtcccc
gacgggctgctgagtcgcgcgctgcgggctggaaggagtcgccgcctggcccgcgtccgc
tccgtctccagcgggaacgaggacgaggagcgccgcgcgggatccgagtccccggcccgg
gccccctcctcgagcccgctgtcatccagggccccgcttcctgagcgcctggaggccaag
ggcaccgtggctctgggccgcgccggcgacgccctgcgcctggctgctgagtactgtccg
ggaacccggcgtctccgcctccggctgctccgcgcggagagcctgttcggaggcgccccc
gggccccgcgccgtccgctgccgcctcagcctcgtcctgcggccgccgggcactgcgcgt
tggcaatgcagcgctgtggtggggcgcagccgcaaggcctcctttgaccaggacttttgc
ttcgacggcctctcggaagacgaggtgcgccgcctggccgttcgcgtcaaggcccgggat
gagggtcgcggccgggatcggggccgcctgctgggccagggtgagctgtccctgggcgcc
ctcctgctgctctga

DBGET integrated database retrieval system