KEGG   Homo sapiens (human): 388135Help
Entry
388135            CDS       T01001                                 

Gene name
INSYN1, C15orf59
Definition
(RefSeq) inhibitory synaptic factor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4589 Trns_repr_metal
Motif
Other DBs
NCBI-GeneID: 388135
NCBI-ProteinID: NP_001034703
OMIM: 617128
HGNC: 33753
Ensembl: ENSG00000205363
Vega: OTTHUMG00000172556
Pharos: Q2T9L4(Tdark)
UniProt: Q2T9L4
Position
15q24.1
AA seq 293 aa AA seqDB search
MNIRGAPDLGQPSDDPSSGGERERIRQRMKMVIGQLEGILRELKEVAKELREVVSQIDKL
TSDFDFELEPDDWTTATVSSTSSSDKAGMGGPFDLGHLDFMTADILSDSWEFCSFLDVST
PSDSVDGPESTRPGAGPDYRLMNGGTPIPNGPRVETPDSSSEEAFGAGPTVKSQLPQRTP
GTRERVRFSDKVLYHALCCDDEEGDGEQEVEEEEVGLPPEPAHTEAHAGPHKPSPAPYKS
RRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTATRQKARGKN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcggggcgccccggacctcgggcagcccagtgacgaccccagcagtggtggt
gagcgggagcggattcgacagcgcatgaagatggtcatcgggcagcttgagggcatcctt
cgcgagctcaaggaggtggccaaggagctgagggaggtggtgagccagatcgataagcta
acctcggacttcgactttgaactggagccggacgactggaccacggccactgtgagcagc
acctctagcagtgacaaggcgggcatgggtggcccctttgacctgggccacctggacttc
atgacagccgatatcctctcagacagctgggagttctgctccttcctggacgtctctacc
ccctcggactccgtggatggtcccgagtcgactcggccaggggctggccctgactaccgc
ctcatgaatggtggcacgcccatccccaatgggccacgagtggagaccccagactcctcc
agtgaggaggcctttggtgctggccccacggtgaagagccagctgccccagcggacccca
gggacacgggagagggtgcggttcagtgacaaagtgctctaccatgctctgtgctgtgac
gatgaggagggggacggtgagcaggaggtggaggaggaagaagtgggcttgccccctgag
cctgcccatacagaggcccatgcaggcccccacaagccctccccagccccctacaagtca
cggcgctctccactgaccagccgccactcaggctctaccttggcccctgaacagactcga
agggtcacgaggaacagcagcacccagacagtgtcagacaagagcacgcagacggttctg
ccctacacagccactagacagaaagccagggggaaaaactag

DBGET integrated database retrieval system