KEGG   Homo sapiens (human): 388325Help
Entry
388325            CDS       T01001                                 

Gene name
SCIMP, C17orf87, UNQ5783
Definition
(RefSeq) SLP adaptor and CSK interacting membrane protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SCIMP UPF0242 WBP-1 DUF2062 SID-1_RNA_chan Cytochrom_B558a DUF4381
Motif
Other DBs
NCBI-GeneID: 388325
NCBI-ProteinID: NP_996986
OMIM: 614406
HGNC: 33504
Ensembl: ENSG00000161929
Vega: OTTHUMG00000132914
Pharos: Q6UWF3(Tdark)
UniProt: Q6UWF3
Position
17p13.2
AA seq 145 aa AA seqDB search
MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKH
KQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVS
IPSYIEPEDDYDDVEIPANTEKASF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggatactttcacagttcaggattccactgcaatgagctggtggaggaataatttctgg
atcatcttagctgtggccatcatcgttgtctctgtgggtctgggcctcatcctgtactgt
gtctgtaagtggcagcttagacgaggcaagaaatgggaaattgccaagcccctgaaacac
aagcaagtagatgaagaaaagatgtatgagaatgttcttaatgagtcgccagttcaatta
ccgcctctgccaccgaggaattggccttctctagaagactcttccccacaggaagcccca
agtcagccgcccgctacatactcactggtaaataaagttaaaaataagaagactgtttcc
atcccaagctacattgagcctgaagatgactatgacgatgttgaaatccctgcaaatact
gaaaaagcatcattttga

DBGET integrated database retrieval system