KEGG   Homo sapiens (human): 388335
Entry
388335            CDS       T01001                                 
Symbol
TMEM220
Name
(RefSeq) transmembrane protein 220
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TMEM220 DUF1295 NCE101 MARVEL YwiC
Other DBs
NCBI-GeneID: 388335
NCBI-ProteinID: NP_001004313
HGNC: 33757
Ensembl: ENSG00000187824
UniProt: Q6QAJ8
Position
17:complement(10711133..10730023)
AA seq 160 aa
MAPALWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWK
SISAIHILFCTVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVG
GRIQLAIAIVITLFPFISWVYIYINKEMRSSWPTHCKTVI
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcgccagcgctgtggcgggcctgcaacggactcatggccgccttcttcgcgctggcg
gccttggtgcaggtaaatgacccagatgcagaggtgtgggtggtggtgtacacaatccct
gcagtactgaccctgcttgttggacttaaccctgaagtcacaggtaatgttatttggaaa
agtatctctgcaatacacatactcttttgtacggtgtgggctgttggcttggcgtcctac
ctcttgcatcgtacacaacagaacatcttacatgaggaagaaggcagggagctgtctggt
ctggtgattattacagcatggattatcctgtgccacagttcctcaaagaatccagttggt
ggaagaattcaattggctattgccattgtaatcacacttttcccatttatctcatgggtc
tacatatatattaacaaggaaatgcggtcctcttggccaactcactgcaagacagtaatt
taa

DBGET integrated database retrieval system