KEGG   Homo sapiens (human): 388419Help
Entry
388419            CDS       T01001                                 

Gene name
BTBD17, BTBD17A, LGALS3BPL, TANGO10A
Definition
(RefSeq) BTB domain containing 17
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BACK BTB
Motif
Other DBs
NCBI-GeneID: 388419
NCBI-ProteinID: NP_001073935
HGNC: 33758
Ensembl: ENSG00000204347
Vega: OTTHUMG00000178580
Pharos: A6NE02(Tdark)
UniProt: A6NE02
Position
17q25.1
AA seq 478 aa AA seqDB search
MPRRGYSKPGSWGSFWAMLTLVGLVTHAAQRADVGGEAAGTSINHSQAVLQRLQELLRQG
NASDVVLRVQAAGTDEVRVFHAHRLLLGLHSELFLELLSNQSEAVLQEPQDCAAVFDKFI
RYLYCGELTVLLTQAIPLHRLATKYGVSSLQRGVADYMRAHLAGGAGPAVGWYHYAVGTG
DEALRESCLQFLAWNLSAVAASTEWGAVSPELLWQLLQRSDLVLQDELELFHALEAWLGR
ARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQFHAASPLHY
AKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLF
SPRWLPVSLRPVYADAAGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQKTVLVGARQQ
GRLLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLVENALHLHLIVKPVYHTLIRTPK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagaggctactccaagcctgggtcctggggcagcttctgggccatgctgacc
ttggtgggcctggtcacccatgcagcacagagagccgatgttggcggggaggcagctggc
acctccatcaaccactcccaggcggtgctccagcgcttgcaggagctgctgcggcagggc
aacgccagcgatgtggttctgcgggtgcaggctgcgggcaccgatgaggtccgggtattc
cacgcccaccgcctgctgctgggactgcacagtgagctgttcctggagctgctaagtaac
cagagcgaggcggtgctgcaggagccacaggactgcgccgctgtcttcgacaagttcatc
aggtacctgtactgcggggagctgaccgtgctgctgacccaggccatccccctgcacaga
ctggccaccaagtacggcgtgtcctccctgcagcgcggcgtggccgactacatgcgcgcg
cacctggcgggaggcgcgggcccggcggtgggctggtaccactacgcggtgggcaccggg
gacgaggccctgcgcgagagctgcctgcagttcctggcctggaacctgtcggccgtggcg
gccagcaccgagtggggcgccgtgagccccgagctgctctggcagctcctgcaacgctcg
gacctggtgctgcaggatgaactggagctgttccacgcgctggaggcctggctgggtcgc
gcgcggccgccccctgccgtggccgagcgggcgctgcgcgccatacgctaccccatgatc
ccaccggcacagctgttccagctgcaggcgcgctcggcagccctggcgcgccacggcccc
gcggtggccgacctcctgctgcaggcctaccagttccacgccgcgtcgccgctgcactac
gccaagttcttcgacgtcaacggcagcgccttcctgccccgcaactacctcgcgcccgcc
tggggcgccccgtgggtcatcaacaacccggcccgcgacgaccgcagcaccagcttccag
acgcagctgggcccgagtggccacgacgcgggccgccgggtcacctggaacgtgctcttc
tcgccgcgctggctgcccgtcagcctgcggcccgtttacgcggacgccgcgggcactgct
ctgcccgccgcgcgcccggaggacggccgaccgcggctggtggtgacgccggccagcagc
ggcggcgacgcggcgggcgtgagcttccagaagacggtgctggtgggggcgcgccagcag
ggccgcctgctggtccgccacgcctacagcttccaccagagcagcgaggaggccggcgac
ttcctggcgcacgccgacctgcagcggcgcaactccgagtacctggttgagaacgccctg
cacctgcacctcatcgtcaagcccgtataccacacccttatccggacccccaagtag

DBGET integrated database retrieval system