KEGG   Homo sapiens (human): 388428
Entry
388428            CDS       T01001                                 

Symbol
PVALEF, AATK-AS1
Name
(RefSeq) parvalbumin like EF-hand containing
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 SPARC_Ca_bdg Dockerin_1 Ku_N
Other DBs
NCBI-GeneID: 388428
NCBI-ProteinID: NP_001341568
HGNC: 40053
Ensembl: ENSG00000225180
Vega: OTTHUMG00000150182
Position
17:81165507..81183166
AA seq 134 aa
MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAI
HTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEE
FSELIKKEKIPKKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggaggaggacttctcctcccagatgaagaagatggccttggccatgggcacgtcccta
tcagacaaggacattgagctgctgcccacagacatgagacaccacgggtccttcaactac
ctcaagttcttcaagcacatccgcaagctccacgcctcgggccagctggacgacgccatc
cacacggccttccagtccctggacaaggacaagagtggcttcattgagtggaacgagatc
aagtacatcctgtccatcatccccagcagcgggcccaccaccccgctgacagacgaggag
gccgaggccatgatccaggcggcagacacacacggggacgggaggatcaactacgaagaa
ttttctgaattgatcaaaaaggagaaaattccaaagaagaagtag

DBGET integrated database retrieval system