KEGG   Homo sapiens (human): 388662Help
Entry
388662            CDS       T01001                                 

Gene name
SLC6A17, MRT48, NTT4
Definition
(RefSeq) solute carrier family 6 member 17
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    388662 (SLC6A17)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   388662 (SLC6A17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF FTR1 Spindle_Spc25 Tmemb_18A
Motif
Other DBs
NCBI-GeneID: 388662
NCBI-ProteinID: NP_001010898
OMIM: 610299
HGNC: 31399
Ensembl: ENSG00000197106
Vega: OTTHUMG00000011761
Pharos: Q9H1V8(Tbio)
UniProt: Q9H1V8
Position
1p13.3
AA seq 727 aa AA seqDB search
MPKNSKVTQREHSSEHVTESVADLLALEEPVDYKQSVLNVAGEAGGKQKAVEEELDAEDR
PAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAV
GQRIRRGSIGVWHYICPRLGGIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWSE
CPVVRNGSVAVVEAECEKSSATTYFWYREALDISDSISESGGLNWKMTLCLLVAWSIVGM
AVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWRE
AATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKAN
IMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSAL
GLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAG
ITTPIIDTFKVPKEMFTVGCCVFAFLVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILEN
IAVAWIYGTKKFMQELTEMLGFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVTPPGYSA
WIKEEAAERYLYFPNWAMALLITLIVVATLPIPVVFVLRHFHLLSDGSNTLSVSYKKGRM
MKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLA
STPESEL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaacagcaaagtgacccagcgtgagcacagcagtgagcatgtcactgagtcc
gtggccgacctgctggccctcgaggagcctgtggactataagcagagtgtactgaatgtg
gctggtgaggcaggcggcaagcagaaggcggtggaggaggagctggatgcagaggaccgg
ccggcctggaacagtaagctgcagtacatcctggcccagattggcttctctgtgggcctc
ggcaacatctggaggttcccctacctgtgccagaaaaatggaggaggtgcttacctggtg
ccctacctggtgctgctgatcatcatcgggatccccctcttcttcctggagctggctgtg
ggtcagaggatccgccgcggcagcatcggtgtgtggcactatatatgtccccgcctgggg
ggcatcggcttctccagctgcatagtctgtctctttgtggggctgtattataatgtgatc
atcgggtggagcatcttctatttcttcaagtccttccagtacccgctgccctggagtgaa
tgtcctgtcgtcaggaatgggagcgtggcagtggtggaggcagagtgtgaaaagagctca
gccactacctacttctggtaccgagaggccttggacatctctgactccatctcggagagt
gggggcctcaactggaagatgaccctgtgcctcctcgtggcctggagcatcgtggggatg
gctgtcgttaagggcatccagtcctcggggaaggtgatgtatttcagctccctcttcccc
tacgtggtgctggcctgcttcctggtccgggggctgttgctgcgaggggcagttgatggc
atcctacacatgttcactcccaagctggacaagatgctggacccccaggtgtggcgggag
gcagctacccaggtcttctttgccttgggcctgggctttggtggtgtcattgccttctcc
agctacaataagcaggacaacaactgccacttcgatgccgccctggtgtccttcatcaac
ttcttcacgtcagtgttggccaccctcgtggtgtttgctgtgctgggcttcaaggccaac
atcatgaatgagaagtgtgtggtcgagaatgctgagaaaatcctagggtaccttaacacc
aacgtcctgagccgggacctcatcccaccccacgtcaacttctcccacctgaccacaaag
gactacatggagatgtacaatgtcatcatgaccgtgaaggaggaccagttctcagccctg
ggccttgacccctgccttctggaggacgagctggacaagtccgtgcagggcacaggcctg
gccttcatcgccttcactgaggccatgacgcacttccccgcctccccgttctggtccgtc
atgttcttcttgatgcttatcaacctgggcctgggcagcatgatcgggaccatggcaggc
atcaccacgcccatcatcgacaccttcaaggtgcccaaggagatgttcacagtgggctgc
tgtgtctttgcattcctcgtggggctgttgttcgtccagcgctccggaaactactttgtc
accatgttcgatgactactcggccaccctgccactcactctcatcgtcatccttgagaac
atcgctgtggcctggatttatggaaccaagaagttcatgcaggagctgacggagatgctg
ggcttccgcccctaccgcttctatttctacatgtggaagttcgtgtctccactatgcatg
gctgtgctcaccacagccagcatcatccagctgggggtcacgcccccgggctacagcgcc
tggatcaaggaggaggctgccgagcgctacctgtatttccccaactgggccatggcactc
ctgatcaccctcatcgtcgtggcgacgctgcccatccctgtggtgttcgtcctgcggcac
ttccacctgctctctgatggctccaacaccctctccgtgtcctacaagaagggccgcatg
atgaaggacatctccaacctggaggagaacgatgagacccgcttcatcctcagcaaggtg
cccagtgaggcaccttcccccatgcccactcaccgttcctatctggggcccggcagcaca
tcacccctggagaccagcggtaaccccaatggacgctatgggagcggctacctgctggcc
agcacccctgagtcggagctgtga

DBGET integrated database retrieval system