KEGG   Homo sapiens (human): 388818
Entry
388818            CDS       T01001                                 
Symbol
KRTAP26-1
Name
(RefSeq) keratin associated protein 26-1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PMG Keratin_B2_2 Keratin_B2 ShK
Other DBs
NCBI-GeneID: 388818
NCBI-ProteinID: NP_981950
HGNC: 33760
Ensembl: ENSG00000197683
Pharos: Q6PEX3(Tdark)
UniProt: Q6PEX3
Position
21:complement(30319124..30320315)
AA seq 210 aa
MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETC
GEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSS
GCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVS
SSLRPLGPLFSGCQPLTHVFSTCRPSCSGL
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcttgccccaactactgctcgggaaactccaactcaggatctctcagaacctcccgc
catattcctctcacctccatcgacctctgccctaccagcgtgagctgtggagatgtcctc
tacttacccactagctctcaagaccatacctgggtcacagacaactgccaagagacctgc
ggtgaaccaaccagctgccagccggtccactgtgagaccggcaatcttgaaacctcttgc
ggttcttccactgcttactacgtgcccaggccttgccaaggaagcagttttcttcctgct
tctttcttctccagttcctgccttccagtatcctgtagaccacagaggtatgtgtccagc
ggctgtcgtccactgaggccgctgctcaatagttaccagcccataggagactgtgtgccc
aatgcctatcgcccccaattctgcttgtccaagagttgccagccccaaaacctcctcact
tctggatgccaaccctcgagttgcttggcctatcgtcctcaaagtcttcacgttgtgtcc
agcagcctcagacctctggggcctctgttcagtggttgccaacctctgacccatgtgttc
agcacgtgtcgtccatcttgctctggactgtga

DBGET integrated database retrieval system