KEGG   Homo sapiens (human): 388960Help
Entry
388960            CDS       T01001                                 

Gene name
C2orf78, COG5373, hCG1989538
Definition
(RefSeq) chromosome 2 open reading frame 78
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4629
Motif
Other DBs
NCBI-GeneID: 388960
NCBI-ProteinID: NP_001073943
HGNC: 34349
Ensembl: ENSG00000187833
Vega: OTTHUMG00000152819
Pharos: A6NCI8(Tdark)
UniProt: A6NCI8
Position
2p13.1
AA seq 922 aa AA seqDB search
MHWLASATQTSASIVSSSLLSAVDVSSSLTMSEYFQNTSLPGTANSRQFSLPVVSNAAFL
TGSISNFSRASAPAISSAWLQPSASGTSFQPLMGSAYLYQHSSTTMLSGVTGQSHICTSA
ASYPGVFEWDSTASTVKKSSSLRDFTVTVIDQNTAVSSMSMTAQYYKTSDTNTMVPLYPS
LSASLVQGTLTQIPNQQGHNLSLPCQIGSQVYYYNQGTLGPQLSCLQSYGSVSYTGYRAS
AHQPEMVMVLKEVQPTNVLPPVSTSGMYYSVSSQPITETSVQVMETSLGMDTSLGLQSPS
QTFCLPQTPEFSKSFSSRNTQTLESNPSPELGDISITPVQSPTNLLTLSPAPSQEKNENE
NLDEIKTNLSKPLDVHQILIGNQDPPLLPVEIPDIHPLLACIDPLGQEEQPGSENANLRN
KSLSLEDQGIFENGIESSSDLADITTWVEDTYLPPIFSSLQDLDQPESPSAKKAKDTSAI
KVNQVQEKSCVIKGHSDQVRKNKHKASEPIQGAPKAKIQPKNPECLLEREVVVGSATVSN
SASVNKAKHSSNKPHKAASSRISKTKSHGQEKTKGNRKNSSKKSEESKQSGKKVKVEEKQ
TIPNMKRKKNQPELSQKTLKKPRSSLGMHMLESVQVFHALGKKIDMKTGFSSSRTLGSSS
NTQNRQPFPALKPWLDIQHEGKGPEKIQVKAQKLDGSAEKECTSPSHSELPPPGKVKLIP
LPFLTLDQPQARHVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGP
ATPAQPISAKATQPSSANPTQPTVPQSAASRPSAYKTSSCSSLQREPVSTAVTSLRSLPK
PQNQFLIQDFSLQPRPWRKPTVPEPVMSTPITEEQRPEREAMKRKAQQERENAAKYTSLG
KVQFFIERERDMEIAEYYGYTI
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcactggttggcttcagccacccagacatccgctagtatcgtctcttcttcccttcta
tctgcagttgatgtttcttcttctctgaccatgtcagaatatttccaaaatacgtcttta
cctggaactgcaaattctcggcagttctctcttcctgtggtgagcaatgcagctttctta
acaggaagcatctccaacttctccagagcctctgctccagccatcagctcagcatggcta
cagccatcagcctctggcacctccttccagccactcatgggcagtgcctacctttaccaa
cattctagcacaactatgttgtctggggttactggccagagccatatctgtacttcagct
gcctcttatccaggcgtttttgagtgggatagtacagcaagcacagtaaagaagtcatcc
tcactcagggacttcactgtgactgtcattgatcagaacacagctgtctcttccatgtct
atgacagcccagtattataaaacttcagataccaatactatggtccctctgtatccatca
ctatctgccagccttgttcaggggacactaactcaaattccaaatcagcagggccataac
ctgtcacttccctgccagataggaagccaggtctattactataatcaaggcacactgggg
cctcaactatcctgcctgcaatcttatggctctgtgtcatacacaggatatagggcttct
gcccatcaaccagaaatggtgatggtgctgaaggaggttcagcccacaaatgtcctacca
ccagtctctacttctgggatgtattactctgtgtcttctcaacccatcacagaaaccagt
gttcaagtgatggaaacttccctggggatggatacttccctgggattgcaatctccaagc
cagacattttgtctgccacaaactccagaattctccaagtccttcagtagcagaaatacc
cagacacttgagagtaacccatcacctgagcttggggacatttcaataactccagtccag
agtcctactaatctcttgacactgtctccagctccaagccaggaaaaaaatgagaatgag
aatttggatgagattaaaaccaacctttcaaagcctctagatgtccaccagatcctaata
ggaaatcaagatcctccactacttcctgtagaaatccccgatattcacccgcttctggcc
tgcattgatcctcttggccaagaggagcagcctggttctgaaaatgccaatctaagaaat
aagagcctgagtcttgaggaccaagggatatttgaaaatgggattgagtctagcagtgat
ttggcagacatcactacatgggtggaggatacttacctccccccgatcttcagttcctta
caagatcttgaccaacctgaaagtccctcagcaaagaaagccaaagataccagtgccatc
aaggtaaatcaggtgcaggaaaagtcatgtgtcataaagggtcactctgatcaagtcagg
aagaacaagcataaagcttccgagcctatccagggtgctcccaaggccaaaatccagcca
aagaacccagagtgcctattagagagagaagtggttgttggcagtgctacagtcagtaac
agcgcttctgtgaacaaggccaagcattctagcaacaaacctcacaaggctgcatccagc
aggatcagcaaaactaagagccatgggcaggaaaagaccaaagggaacagaaagaacagc
tccaagaaatctgaagagagtaagcagtcagggaaaaaagtcaaggtagaagagaagcaa
accattcccaatatgaaacggaagaaaaatcaacctgagcttagccaaaagacccttaaa
aagccccgaagctccctaggcatgcacatgctagagtccgtgcaagttttccatgcactc
gggaaaaagatcgatatgaaaactggattctcttcctccaggaccctgggaagctcaagc
aacacccaaaaccgccagccattcccagctctcaaaccatggctggatatccaacatgag
ggtaaaggcccggagaaaattcaagtcaaggcccagaaactagatggtagtgctgaaaaa
gagtgtacatctccatcccactctgagttgccaccacctgggaaggtcaagttgatacct
ttgccctttctgaccctggaccaacctcaagctcgacatgtttctcggcggccaaaccct
ctagcctcacgtaggcctgctgtggcttaccctgctcgacctgattctactaactcagct
caatcgaatgcagtcaatccatcccgaccagctcctaccaacacatctttgacaggtcct
gccacaccagctcagccaatttcagccaaagcaacccaacccagttcagccaaccctacc
cagcctactgtccctcaatctgctgcttctaggccatcagcctacaaaacatcatcttgt
tcttctctgcagcgggagcctgtttccactgctgtgaccagtctccggtcactgcccaag
cctcaaaatcaatttctaatccaagacttcagcctccaaccccgtccatggaggaaaccc
actgttcctgagccagtaatgtcaacgcccatcacagaagagcagaggccagagcgtgag
gccatgaagagaaaggctcaacaagagcgtgagaatgctgccaaatacacctctttgggg
aaagtgcagtttttcattgaaagggaaagagatatggaaattgctgaatactatggctac
acaatctaa

DBGET integrated database retrieval system