KEGG   Homo sapiens (human): 389125
Entry
389125            CDS       T01001                                 

Gene name
MUSTN1, MUSTANG
Definition
(RefSeq) musculoskeletal, embryonic nuclear protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mustang
Other DBs
NCBI-GeneID: 389125
NCBI-ProteinID: NP_995325
OMIM: 617195
HGNC: 22144
Ensembl: ENSG00000272573
Vega: OTTHUMG00000159024
Pharos: Q8IVN3(Tdark)
UniProt: Q8IVN3
Position
3p21.1
AA seq 82 aa
MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSR
TRTGTETVFEKPKAGPTKSVFG
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtcccaggctggtgctcaggaagcccctatcaagaagaagcgcccccctgtgaaggac
gaggacctgaagggggcccgaggaaacctgaccaagaaccaggaaatcaagtccaagacc
taccaggtcatgcgagagtgtgagcaagctggctcggccgccccgtcggtgttcagccgc
acccgcacaggtaccgagactgtctttgagaagcccaaagccggacccaccaagagtgtc
ttcggctga

DBGET integrated database retrieval system