KEGG   Homo sapiens (human): 389151
Entry
389151            CDS       T01001                                 
Symbol
PRR23B
Name
(RefSeq) proline rich 23B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF2476
Other DBs
NCBI-GeneID: 389151
NCBI-ProteinID: NP_001013672
HGNC: 33764
Ensembl: ENSG00000184814
Vega: OTTHUMG00000160633
Pharos: Q6ZRT6(Tdark)
UniProt: Q6ZRT6
Position
3:complement(139019031..139020926)
AA seq 265 aa
MVSRPRSPSAFPAPWWGQQPGGPGPAKRLRLEEPAGPEPRAAPSLEDPAGDPAVDALTSI
VVLAAGCALRVPLDDVDLVLEPAPTSILRVSLGGHTLILIPEVLLSSVDERSGAQHDSSA
GLEVDVFLGAVREDVVVELEFCASVPEIAAQEEAYEEDADPEFPELRMDSPTGSAAGLYP
SSRSMFIPYREGPIPEPCALAPNPSSERRSPRPIFDLEFRLLEPVPSSPLQPLPPSPCVG
SPGPHARSPLPERPPCKARRRLFQA
NT seq 798 nt   +upstreamnt  +downstreamnt
atggtcagccggccccgcagccccagcgccttccctgctccctggtggggacagcagcca
ggaggacccggccctgccaagcgcctccgattggaggagcccgcgggccccgaaccccgc
gcggcacccagcctggaagacccggcgggggacccggccgtggacgcgctcacctccata
gtggtcctggccgcgggctgtgccctgcgtgtgcccctggacgacgtcgacctggtgctg
gagcccgcaccaacgtcgatcctgcgagtgtctctcggtggacacaccctcatcctgatc
ccagaggtcctcctgagctccgtcgacgaacgctcaggagcgcagcacgactcgtctgcc
gggctggaagtggacgttttcctgggcgctgtcagggaggacgtcgtcgtcgagctggaa
ttctgcgcatctgtcccagagatcgccgcccaggaagaggcctacgaggaggacgcggac
cccgagttcccggagctccggatggactccccaaccggctcagccgctgggctctacccc
tcctctagaagtatgttcatcccctaccgggagggccccatcccagaaccctgtgctctg
gcccccaaccccagttcagagagacgttctccacgccccatctttgacctggaattccgc
cttctggagcctgtccccagctcacctctccaacctctacctccctctccgtgcgtgggg
agtccaggtccccacgcgcgctcgccgctcccggaacgccctccgtgcaaggcccggaga
cgcctgttccaggcatag

DBGET integrated database retrieval system