KEGG   Homo sapiens (human): 389197
Entry
389197            CDS       T01001                                 
Symbol
C4orf50
Name
(RefSeq) chromosome 4 open reading frame 50
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4527
Other DBs
NCBI-GeneID: 389197
NCBI-ProteinID: NP_001351618
HGNC: 33766
Ensembl: ENSG00000181215
Position
4:complement(5897587..6018546)
AA seq 1508 aa
MEPTAKGRTEESFSYVIRAPSSEGFDIMNVDVKIDTSWIFQDMEDSAEERECLQEEAAGR
PDMDMGALRRQLESSEQKLSAAEDKYVTSESGLRSRIQELELSERKLLRKVDQLSTHVAQ
ERSAWLQAQEKLAALQGELASQIREESVARRQQWRLRRLQERLRRKDEALGQQAAALERC
RRTQRRQLGLVREQERVLREQVQRLERNVRRLCRAAGLLLAQWDTAAPGSQGATEAAAEL
RALQARAERSEREREEAARSLQEHRATERQLRGQLEELRCCIYGLKLSEIGLQGQVEDLA
QQNQCLREELGAQAPIGHCSLDALGCVQGDSLPLPREEALDPCRSQDWRNSLRSNDAPRQ
RAPAGQSPEGPCTWSRIRPGRASSVLAPGPETTSELPRDLAGSNREQLTLAEPSLDEQIL
LLVCGCPPEECLDESLLRMDLAWISENLAADPAAEAFLLVQTSALPLWGPAGDSASWRPL
LLQEVPSDGQKIQEELATRSPPPPKATGHPGWDCHQTRGRGASLFHEAPYISNHPFLKKH
PKDLKDTWNNGGGSLAGRTEEGKARGTLGRKGKNLGDKYQLSQESHQNLSLENGAGAAED
VQDQNGASETKAATCRPGSWQEFLMPLLQGEASVSKEGPESLSRRERVEGYVWGLRGGLS
SENEEVAPPATFSRAHETKEPWPTDSQLLAGKVRATGRTARGKEENQVWLGNALLLQGGS
LEDKGLEEEDEMPHQEASGLGCRGAPEEPDSQEHESKEMLFFAGETGLPLFPRFALSVEG
AEPTDHGHPQAVSKGHNRCALTIDELAQDVEACFQQLSTLQPGSRGWQCSASACRGENWS
FAQKWHSGWERAHSQQVWGNWGICSNEEAKSKESGEGDKPGKTTALGTSEVPGNPGTLPH
WDEASPNPPQGPAEPWGALERVRSRFHQLISGLKKQRSQILHDNTKLHGDQERFHERVCA
LEREREREVTKISRLERDNHRLVGDISQLKKELDQYLQAISDLEDCNGKSYCKILELEEE
NETLKGNLGQLQKATSESVRKSKDTMEQVTLENWKLQTLISELGVSYKELIKDIVLGIED
MIRALSGENEHLLRRVHVLEREVTLQRSTDQGRLVRGREHLQGKAKMHALDKEVQVTPLT
GQLLSRACGPPLEEEMSLAAGQTGPSTGTGNSRRGADSPPPSLVWRNTGVANALQGNVSG
AEVKEAHLEKEEKRPRCSVAQGQALSSLSNGPMLRDSEAEVTEEDPRLRAQQLHHRVLTL
QCQLRDQGAAHQASLDEATRLQEELQAKLEELQKKQHEAKLAVTPLKAKIASLVRKCRER
NRLITHLLQELHRHGLGNLLLSELAQNMLNDVALAEYTATFLAPGVPETSHHLDVKSEMT
AALRAQTYLLNPEMDSVLQSSLSSESWPIPEPEWPAQTAQLDSLKLPLSLVSTLDPGTCL
AAVTVEPGLPAQRLQEKGGMPCPALQVDNVPAPSELLSPARILAFHQELRQSICSNSQVH
KSPLELEM
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggagccaacagccaagggacggactgaggagagtttcagctacgtcatcagagccccc
agcagtgaggggttcgacataatgaacgttgatgtgaagattgacacatcctggatattc
caggacatggaagatagtgctgaggagcgggaatgtcttcaggaagaagcagctggccgc
ccagacatggatatgggtgcgctcaggaggcagctggagtcctccgagcagaagctgtca
gcagcagaggacaagtacgtgacatcggagtccgggctgagaagcagaattcaggagctg
gagctgtcagaaaggaaactcctccggaaggtggaccagctgagcacccacgtggcccag
gagagaagcgcctggctccaggcccaggagaagctggcggcgctgcagggggagctggcc
agccagatccgggaggagagcgtggccaggcggcagcagtggcggctgcggcggttgcag
gagcggttgcggcgcaaggacgaggcactggggcagcaggcggcggccctggagcgctgc
cggcggacccagcggcgccagctgggcctggtgcgggagcaggagcgcgtcctgcgggag
caggtgcagcggctggagcgcaacgtgcggcgcctctgccgcgccgcgggcctcctgctg
gcccagtgggacaccgcggccccaggctcccagggcgccaccgaggcggctgcggaactg
cgcgccctgcaggcgagggcagagcgcagcgagcgcgagcgggaagaggcggcgcgcagc
ctgcaggagcaccgggccaccgagcgccagctccgcgggcagctggaggagctgcgctgc
tgcatctatgggctgaagctgtcagagattggcctgcagggccaggtggaggacctcgcc
cagcaaaaccagtgcctgcgagaggagctgggagcccaggcccctattggtcactgcagc
ctggatgctctgggctgtgttcagggtgactcactgcccctgcccagggaggaggccctg
gacccctgcagaagccaagactggcggaactccctgcggtccaatgatgcacccagacaa
agggccccagcaggccagtccccagaggggccctgcacctggagccgcatcaggcctgga
cgggcctcttctgttttggctccaggcccggagaccacaagcgagctccccagagacctg
gccggatccaaccgtgaacagcttactctggcagagcccagcttggatgaacagattctt
ctcctggtctgtggctgcccaccagaggagtgcttggacgagtcactcctccgcatggac
ctggcctggatttcagagaatctagcagctgacccagctgcagaagcctttctcctggtg
cagacatccgcactccctctctgggggccggctggggactccgcttcttggcgaccactg
ctgctccaggaggttccctcagatggacaaaaaatccaagaagagttggccaccaggtcc
ccgcctcctcccaaagccacaggacacccaggctgggattgtcaccagacaagaggccgc
ggtgcctccctcttccacgaggccccctacatttcaaatcacccatttctgaaaaaacac
cccaaggatctgaaagacacttggaacaatggaggaggaagccttgcggggagaactgaa
gaggggaaggcaagggggactttgggcaggaaggggaaaaaccttggtgacaagtaccag
ctaagtcaggaaagccatcagaacctgagcttggagaatggggctggagctgcagaggac
gtgcaggatcagaatggggcttcagagactaaggccgccacctgccgccctgggtcctgg
caggagtttttgatgcctcttctacagggggaggcctcagtatcaaaggagggtcccgaa
tccctgagcaggagggaaagggtggaaggatacgtctggggtctccgaggaggactgtca
tcagagaatgaggaagtggcacccccagccaccttctccagggctcatgagaccaaagag
ccatggccaacagacagtcagctcctcgcagggaaagtcagagccactgggaggacagct
aggggcaaggaggaaaaccaagtgtggcttggaaatgctctgcttctgcaaggaggaagc
ctggaggacaaagggctagaggaagaggatgagatgccgcatcaagaagcatccggtctg
gggtgcaggggtgcccccgaggagcctgactcccaggaacatgagagcaaggaaatgctt
ttctttgcaggagagacaggtttgccactgtttcccagatttgccttatcagttgaaggg
gccgaacccactgatcatggtcatccacaggctgtgagcaaaggacacaacaggtgtgca
ctcacaatcgatgagcttgcacaggacgtggaggcttgtttccagcagctgtccaccctg
cagccgggcagcaggggctggcagtgctcagcctctgcatgtaggggagagaactggagc
tttgctcagaagtggcacagtggctgggagagagctcactctcagcaggtttggggaaat
tggggtatttgttctaatgaagaagcgaagtctaaagagagtggtgaaggtgataagccg
ggaaagaccacggccctgggcaccagcgaagttcctggtaacccagggacactgcctcat
tgggatgaagccagcccaaaccctccacaggggcctgctgagccctggggtgccctcgag
agagtgaggagcaggtttcatcagctcatttctggattgaagaaacagagaagccagatt
ttacatgacaacaccaaacttcacggagaccaagagaggttccatgaaagagtgtgcgcc
cttgaaagagagagagagagagaggtgacaaaaatatccaggctcgagcgggataaccac
aggctggtaggggacatctctcagttaaagaaagaactggatcaatatttacaggcaatc
tctgaccttgaagactgcaatgggaagagttactgcaaaattttggagcttgaagaggaa
aatgaaacactgaaagggaatctgggccaactccagaaagccacgtctgagagtgtcagg
aaatccaaagacacgatggagcaagtcaccctggaaaactggaagctccagacactgatc
tcggagcttggcgtcagttataaagagctgataaaggatatcgtgctaggaatagaagac
atgatccgggccttaagtggggagaacgagcaccttctacgcagggtccatgtcctggag
agggaagtcaccttgcagaggagcacggatcaggggcgtttggtgaggggaagggagcac
ctccagggaaaagccaagatgcacgctctagacaaagaggtgcaggtgactccactcaca
ggacagctgctttcaagagcctgtgggccacccttggaggaggaaatgagtctggctgca
gggcagacaggaccttccacaggcaccgggaattccagacgcggtgctgattctccccct
ccatcgctggtctggagaaacactggtgtagccaatgccctgcaaggaaatgtcagtgga
gcagaagtgaaagaagcacatttggagaaagaggagaagaggcccaggtgttctgtggct
caggggcaagctctgagctccctgagcaatggccccatgctccgggactcagaggccgag
gttactgaggaggatcccaggctgcgggcccagcagctccatcaccgggtgctgaccctg
cagtgccagctcagggaccagggcgctgcccaccaggcgtctctggacgaggccacccgc
ctccaggaggagctccaggccaagcttgaagaacttcagaaaaagcaacatgaagcaaag
ttggcagtgactcccctgaaggccaagatagcttccctcgtccggaagtgccgggagagg
aaccgcctgatcacccacctgctgcaggagctgcacagacatgggctggggaacctcctg
ctctccgagctggcgcagaacatgctcaacgacgtggcactggctgagtacacggccacc
ttcctggctccgggagtcccagagacaagccaccacctggacgtcaagtctgagatgacg
gcagctttaagagctcagacatacctcttgaatcctgaaatggacagtgtcctccaaagc
tcattgtcttcagagtcctggcctattcccgagccggagtggccagcacagacagcccaa
ctggattctctgaagctccctctgtccttggtgtccacgcttgatcctggaacgtgcctg
gcagcggtcactgtggaaccaggtctccccgcacaacgtctgcaagaaaaaggcggaatg
ccctgtcctgccctccaagtcgataacgtcccagcaccctctgagctcctgagcccagca
aggatcctggcttttcaccaagagcttagacaaagcatttgcagcaattcccaggtccat
aaatcaccgctggagttagaaatgtaa

DBGET integrated database retrieval system