KEGG   Homo sapiens (human): 389376Help
Entry
389376            CDS       T01001                                 

Gene name
SFTA2, GSGL541, SFTPG, SP-G, UNQ541
Definition
(RefSeq) surfactant associated 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SFTA2 RFX5_N YcgR_2
Motif
Other DBs
NCBI-GeneID: 389376
NCBI-ProteinID: NP_995326
HGNC: 18386
Ensembl: ENSG00000196260
Vega: OTTHUMG00000031183
Pharos: Q6UW10(Tdark)
UniProt: Q6UW10 A0A1U9X8K0
Position
6p21.33
AA seq 78 aa AA seqDB search
MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSG
TSVTLHHARSQHHVVCNT
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgggctgccccttgtcctcctcttgaccctccttggcagctcacatggaaca
gggccgggtatgactttgcaactgaagctgaaggagtcttttctgacaaattcctcctat
gagtccagcttcctggaattgcttgaaaagctctgcctcctcctccatctcccttcaggg
accagcgtcaccctccaccatgcaagatctcaacaccatgttgtctgcaacacatga

DBGET integrated database retrieval system