KEGG   Homo sapiens (human): 389541
Entry
389541            CDS       T01001                                 
Symbol
LAMTOR4, C7orf59
Name
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
  KO
K20399  ragulator complex protein LAMTOR4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    389541 (LAMTOR4)
SSDB
Other DBs
NCBI-GeneID: 389541
NCBI-ProteinID: NP_001008396
OMIM: 618834
HGNC: 33772
Ensembl: ENSG00000188186
Pharos: Q0VGL1(Tdark)
UniProt: Q0VGL1
Structure
Position
7:100148918..100154203
AA seq 99 aa
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttctgcgctgacccaggggctggagcgaatcccagaccagctcggctacctggta
ctgagtgaaggtgcagtgctggcgtcatctggggacctggagaatgatgagcaggcagcc
agtgccatctctgagctggtcagcacagcctgcggtttccggctgcaccgcggcatgaat
gtgcccttcaagcgcctgtctgtggtctttggagaacacacactgctggtgacggtgtca
ggacagagggtgtttgtggtgaagaggcagaaccgaggtcgggagcccattgatgtctga

DBGET integrated database retrieval system