KEGG   Homo sapiens (human): 389692Help
Entry
389692            CDS       T01001                                 

Gene name
MAFA, INSDM, RIPE3b1, hMafA
Definition
(RefSeq) MAF bZIP transcription factor A
  KO
K07595  transcription factor MAFA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04930  Type II diabetes mellitus
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    389692 (MAFA)
   04950 Maturity onset diabetes of the young
    389692 (MAFA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    389692 (MAFA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    389692 (MAFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 HOOK KASH_CCD FapA
Motif
Other DBs
NCBI-GeneID: 389692
NCBI-ProteinID: NP_963883
OMIM: 610303
HGNC: 23145
Ensembl: ENSG00000182759
Vega: OTTHUMG00000165037
Pharos: Q8NHW3(Tbio)
UniProt: Q8NHW3
Structure
PDB: 

Position
8q24.3
AA seq 353 aa AA seqDB search
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS
GYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDM
GAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHHVRLEERFSDDQLVSMSVREL
NRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEV
GRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTADFFL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggagctggcgatgggcgccgagctgcccagcagcccgctggccatcgagtac
gtcaacgacttcgacctgatgaagttcgaggtgaagaaggagcctcccgaggccgagcgc
ttctgccaccgcctgccgccaggctcgctgtcctcgacgccgctcagcacgccctgctcc
tccgtgccctcctcgcccagcttctgcgcgcccagcccgggcaccggcggcggcggcggc
gcggggggcggcggcggctcgtctcaggccgggggcgcccccgggccgccgagcgggggc
cccggcgccgtcgggggcacctcggggaagccggcgctggaggatctgtactggatgagc
ggctaccagcatcacctcaaccccgaggcgctcaacctgacgcccgaggacgcggtggag
gcgctcatcggcagcggccaccacggcgcgcaccacggcgcgcaccacccggcggccgcc
gcagcctacgaggctttccgcggcccgggcttcgcgggcggcggcggagcggacgacatg
ggcgccggccaccaccacggcgcgcaccacgccgcccaccatcaccacgccgcccaccac
caccaccaccaccaccaccaccatggcggcgcgggacacggcggtggcgcgggccaccac
gtgcgcctggaggagcgcttctccgacgaccagctggtgtccatgtcggtgcgcgagctg
aaccggcagctccgcggcttcagcaaggaggaggtcatccggctcaagcagaagcggcgc
acgctcaagaaccgcggctacgcgcagtcctgccgcttcaagcgggtgcagcagcggcac
attctggagagcgagaagtgccaactccagagccaggtggagcagctgaagctggaggtg
gggcgcctggccaaagagcgggacctgtacaaggagaaatacgagaagctggcgggccgg
ggcggccccgggagcgcgggcggggccggtttcccgcgggagccttcgccgccgcaggcc
ggtcccggcggggccaagggcacggccgacttcttcctgtag

DBGET integrated database retrieval system