KEGG   Homo sapiens (human): 389799
Entry
389799            CDS       T01001                                 
Symbol
CFAP77, C9orf171
Name
(RefSeq) cilia and flagella associated protein 77
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CFAP77
Other DBs
NCBI-GeneID: 389799
NCBI-ProteinID: NP_997300
HGNC: 33776
Ensembl: ENSG00000188523
Pharos: Q6ZQR2(Tdark)
UniProt: Q6ZQR2
Position
9:132410211..132573319
AA seq 320 aa
MPEARSSGPDLTRWRKQQQPVRRTVSQVCPPPRRPLTVADIRSGMENERLGVVRDSMFQN
PLIVKAAGPASVGTSYSVYDSSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFN
YGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQL
NDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIK
LEKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKA
HREECAVRQGTLRMGNYTHP
NT seq 963 nt   +upstreamnt  +downstreamnt
atgccagaggccaggagctccggcccggacctcacgcgatggaggaagcagcagcagcct
gtgcgccgcacggtcagccaggtctgcccgcccccgcggcggcccctgaccgtggcggac
atccgttccggcatggagaacgagcggctgggggtcgtgcgggactccatgtttcagaac
cctctcatcgtcaaggctgccggcccggcctcggtgggaacctcttattctgtttatgac
tcctcagcggtgcagaaagttattccttcccttgctggacaccacatcaaaggaggccca
caggctgaactcggcaagccccgggaaagaagctacagtctgcccggcattaattttaat
tatggactctacatccgagggcttgacggaggagtccctgaagccatcggacgctggaac
gtgttcaagcagcagcccacctgcccccacgagctgacccggaattatatcgcaatgaac
cgcggggcggtgaaagccggcctggtgactgcccgggagaacttgctctaccgtcagctc
aatgacatccgcatcagtgaccaggatgaccggcgcatgaagaaagagccgccccctctc
cctccaaacatgacatttgggatccgggcacggccttccacacccttctttgatctgctg
cagcaccggtacctgcagctgtgggtacaggaacaaaaggccacccagaaagccatcaaa
ctggagaagaagcagaaggtggtccttgggaagctgtatgagacccggagcagtcagctg
aggaagtacaagccgcccgtgaagctggacaccctctggcacatgcctcacttccagaag
gtgggccgccaccttgatacgttccccacggaggccgatcgccagagagcattaaaagcc
caccgggaagagtgtgccgtgcgccaggggaccctgcggatgggcaactacacccacccc
tag

DBGET integrated database retrieval system