KEGG   Homo sapiens (human): 389840Help
Entry
389840            CDS       T01001                                 

Gene name
MAP3K15, ASK3, bA723P2.3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 15
  KO
K13986  mitogen-activated protein kinase kinase kinase 15 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    389840 (MAP3K15)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     389840 (MAP3K15)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   389840 (MAP3K15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4071 Pkinase Pkinase_Tyr SAM_KSR1 Kinase-like Pkinase_fungal MCM_N
Motif
Other DBs
NCBI-GeneID: 389840
NCBI-ProteinID: NP_001001671
OMIM: 300820
HGNC: 31689
Ensembl: ENSG00000180815
Vega: OTTHUMG00000022724
Pharos: Q6ZN16(Tchem)
UniProt: Q6ZN16
Position
Xp22.12
AA seq 1313 aa AA seqDB search
MESGGGNAPAGALGAASESPQCPPPPGVEGAAGPAEPDGAAEGAAGGSGEGESGGGPRRA
LRAVYVRSESSQGGAAGGPEAGARQCLLRACEAEGAHLTSVPFGELDFGETAVLDAFYDA
DVAVVDMSDVSRQPSLFYHLGVRESFDMANNVILYHDTDADTALSLKDMVTQKNTASSGN
YYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLCMPLVDRFISLLKDIHVTSC
VYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDA
MVKLVETLEMLPTCDLADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQSCDHPGPDM
FCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETS
LELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVW
YLRSLVQNLLLIRRFKKTIIEHSPRQERLNFWLDIIFEATNEVTNGLRFPVLVIEPTKVY
QPSYVSINNEAEERTVSLWHVSPTEMKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNS
DDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGETDGDTLEYEYDHDANGERVVLGK
GTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENG
YIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVL
VNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCT
IIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTA
ELLREGFLRQVNKGKKNRIAFKPSEGPRGVVLALPTQGEPMATSSSEHGSVSPDSDAQPD
ALFERTRAPRHHLGHLLSVPDESSALEDRGLASSPEDRDQGLFLLRKDSERRAILYKILW
EEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRVMATTISKLKVDLDF
DSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILIPELRAHFE
PTCETEGVDKDMDEAEEGYPPATGPGQEAQPHQQHLSLQLGELRQETNRLLEHLVEKERE
YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEK
IVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKDKA
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atggagagcggcggtgggaatgctccggccggggccctcggggcggcgagcgagtcccct
cagtgcccgccgccgccgggggtggagggcgcggccgggccggcggagcccgacggggcg
gcggagggcgcggcaggcggcagcggcgagggcgagagtgggggcgggccgcggcgggct
ctgcgggcagtatacgtgcgcagtgagagctcccagggcggcgcggccggcggcccggag
gctggggcgcggcagtgcctgctgcgggcctgcgaggccgagggcgctcacctcacctcc
gtgcccttcggggagctggacttcggggagacggccgtgctcgacgccttctacgacgca
gatgttgctgtggtagacatgagcgatgtctccagacagccttccctcttctaccatctt
ggagtccgagaaagctttgacatggccaataatgtgatcttgtaccatgacaccgatgcc
gacactgctctctctttgaaggacatggtaactcaaaaaaacacagcatccagtggaaat
tattatttcatcccatacatcgtgacaccgtgcgctgattatttttgctgcgagagtgat
gcccagagacgagcctccgagtacatgcagcccaactgggacaacatcctgggcccgctg
tgcatgcctttggtggacaggttcattagcctccttaaggacatccacgtgacctcatgt
gtttattacaaagaaaccttgttaaatgacatccggaaagccagagagaaataccaaggt
gaggaactggcgaaggagctagctcggatcaagctccgcatggataatactgaggttctg
acctcagacatcatcattaacttactcctgtcctaccgtgatatccaggactatgatgcg
atggtgaagctggtggaaacactggagatgctgcctacgtgtgatttggccgatcagcat
aacattaaattccactatgcgtttgcactgaataggagaaacagcacaggtgaccgtgag
aaggctctgcagatcatgctccaggttctgcagagctgtgatcacccgggccccgacatg
ttctgcctgtgtgggaggatctacaaggacatcttcttggattcagactgcaaagatgac
accagccgcgacagcgccattgagtggtatcgcaaagggtttgaactccagtcatccctc
tattcgggaattaatcttgcagttttgctgattgttgctggacaacaatttgaaacttcc
ttggaactaaggaaaataggtgtccggctgaacagtttgttgggaagaaaagggagcttg
gagaaaatgaacaattactgggatgtgggtcagttcttcagcgtcagcatgctggcccat
gatgtcgggaaagccgtccaggcagcagagaggttgttcaaactgaaacctccagtctgg
tacctgcgatcattagttcagaacttgttactaattcggcgcttcaagaaaaccattatt
gaacactcgcccaggcaagagcggctgaacttctggttagatataatttttgaggcaaca
aatgaagtcactaatggactcagatttccagttctggtcatagagccaaccaaagtgtac
cagccttcttatgtttccataaacaatgaagccgaggagagaacagtttctttatggcat
gtctcacccacagaaatgaaacagatgcacgaatggaattttacagcctcttccataaag
ggaataagcctatcaaagtttgatgaaaggtgttgttttctttatgtccatgataattct
gatgactttcaaatctacttttccaccgaagagcagtgcagtagatttttctctttggtc
aaagagatgataaccaatacagcaggcagtacggtggagctggagggagagaccgatgga
gacaccttggagtatgagtatgaccatgatgcaaatggtgagagagttgtcttggggaaa
ggcacgtatgggattgtgtatgctggccgagatctgagcaatcaagtgcgaatagccatc
aaagaaatcccggagagagatagcaggtattctcagcctctgcacgaggagatagccctg
cacaagtaccttaagcaccgcaatatcgttcagtacctgggctctgtttcagagaacggc
tacattaagatatttatggagcaggtgcctggaggaagcctttctgctcttctgcgatcc
aaatgggggccgatgaaggaaccgacaatcaagttttacaccaaacagatcctggagggc
cttaagtatcttcatgaaaaccagatcgtgcacagagacataaagggcgataatgttctg
gtgaacacctacagcggagtggtgaaaatctccgattttggaacctcgaaacgtcttgcg
ggtgtgaacccctgcacagagacttttactggcaccctgcagtacatggcacctgagata
attgaccaagggcctcgcggatatggtgccccagccgatatctggtccctgggctgcacc
atcattgagatggccaccagcaagcctccgttccatgagcttggtgagccgcaggcagcc
atgttcaaagtgggcatgtttaagatccaccctgagattccagaagccctttcagctgaa
gcccgagccttcattttatcctgtttcgagcctgacccccacaaacgtgccaccactgct
gagctactgagagagggtttcttaaggcaggtgaacaagggcaagaagaaccgaattgcc
ttcaagccctcagaaggtccccgcggtgtcgtcctggccctgcccacacagggagagccc
atggccaccagcagcagcgagcacggctctgtctccccagactccgacgcccagcctgac
gcactctttgagaggacccgggcgcccaggcaccaccttggccacctcctcagtgttcca
gacgagagctcagccttggaagaccggggcttggcctcgtccccggaggacagggaccag
ggcctcttcctgctacgcaaggacagtgagcgccgtgccatcctgtacaaaatcctctgg
gaggagcagaaccaggtggcttccaacctgcaggagtgtgtggcccagagttccgaagag
ttgcatctctcagttggacacatcaagcaaatcattgggatcctgagggacttcatccgc
tccccagagcaccgggtgatggcgaccacaatatcaaagctcaaggtggacctggacttt
gacagctcgtccatcagtcagattcacctggtgctgttcggatttcaggatgccgtaaat
aaaattttgaggaaccacttaattaggccccactggatgttcgcgatggacaacatcatc
cgccgagcggtgcaggccgcggtcaccattctcatcccagagctccgagcccactttgag
cctacctgtgagactgaaggggtagataaggacatggatgaagcggaagagggctatccc
ccagccaccggacctggccaggaggcccagccccaccagcagcacctgagcctccagctg
ggtgagctcagacaggagaccaacagacttttggaacacctagttgaaaaagagagagag
taccagaatcttctgcggcaaactctagaacagaaaactcaagaattgtatcaccttcag
ttaaaattaaaatcgaattgtattacagagaacccagcaggcccctacgggcagagaaca
gataaagagcttatagactggttgcggctgcaaggagctgatgcaaagacaattgaaaag
attgttgaagagggttatacactttcggatattcttaatgagatcactaaggaagatcta
agataccttcgactacggggtggtctcctctgcagactctggagtgcggtctcccagtac
agaagggctcaggaggcctcagaaaccaaagacaaggcttga

DBGET integrated database retrieval system