KEGG   Homo sapiens (human): 389898Help
Entry
389898            CDS       T01001                                 

Gene name
UBE2NL, Li174
Definition
(RefSeq) ubiquitin conjugating enzyme E2 N like (gene/pseudogene)
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    389898 (UBE2NL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    389898 (UBE2NL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    389898 (UBE2NL)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    389898 (UBE2NL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     389898 (UBE2NL)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   389898 (UBE2NL)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    389898 (UBE2NL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 389898
NCBI-ProteinID: NP_001013007
HGNC: 31710
Ensembl: ENSG00000276380
Vega: OTTHUMG00000188525
Pharos: Q5JXB2(Tdark)
UniProt: Q5JXB2
Position
Xq27.3
AA seq 153 aa AA seqDB search
MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLA
EEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDD
PLANDVVEQWKTNEAQAIETARAWTRLYAMNSI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgccccacaggatcatcaaggaaacccagcgtttgctggcagagccagtt
cctggcatcaaagcagaaccagatgaaagcaacgcccgttattttcatgtggtcattgct
ggggaatcaaaggattccccctttgagggagggacttttaaacgtgaactattacttgca
gaagaatacccaatggcagcccctaaagtacgtttcatgaccaaaatttatcatccaaat
gtagacaagttggaaagaataagtttagatattttgaaagataagtggtccccagccctg
cagatccgcacagttctgctatcgatccaggccttgttaaatgctcccaatccagatgat
ccattagcaaatgatgtagtggagcagtggaagaccaacgaagcccaagccattgaaaca
gctagagcatggactaggctatatgccatgaatagtatttaa

DBGET integrated database retrieval system