KEGG   Homo sapiens (human): 3899Help
Entry
3899              CDS       T01001                                 

Gene name
AFF3, LAF4, MLLT2-like
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    3899 (AFF3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     3899 (AFF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AF-4
Motif
Other DBs
NCBI-GeneID: 3899
NCBI-ProteinID: NP_002276
OMIM: 601464
HGNC: 6473
Ensembl: ENSG00000144218
Vega: OTTHUMG00000153011
Pharos: P51826(Tbio)
UniProt: P51826
Position
2q11.2
AA seq 1226 aa AA seqDB search
MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQN
QPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEESRSGETNS
CVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
SNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGSESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAP
GSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGA
NCHRPEEPAAADALGTSVVVPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVP
KSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGSGPR
APVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKIDLTLLSRIPE
HLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSS
RPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGH
RDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQ
GPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKR
DHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPASSVGSQGSLSNAS
ALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVT
LHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcactgtgtgtctat
gaaccagatagaaatgcattacggaggaaagaacgagaaagaagaaatcaagaaactcaa
caggatgatggcacgtttaattctagttactctctcttcagtgagccctacaagactaac
aagggggatgaactctccaaccggatccagaacactttaggcaattatgatgaaatgaaa
gactttttaactgatagatccaatcagagtcatctcgttggagttcccaaacctggggtt
cctcagactcctgtgaacaagatcgatgaacattttgttgcagattcaagagcccagaac
cagccctcgtctatctgtagcactacaacttccacaccagcagctgtccccgtgcagcag
agtaagagaggcactatgggctggcagaaggctgggcacccaccctctgacggccaacag
agagcaacacaacagggctctctcaggaccttgcttggagatggtgttggcagacagcag
cctcgggccaaacaagtgtgcaatgtggaggtgggccttcagacccaggagaggccacct
gccatggcggccaagcacagcagcagcggacactgtgttcagaactttcctccatcccta
gcttcaaaacccagcctggtccagcagaaaccgaccgcgtatgtgaggccaatggacggc
caagatcaggcccctgatgagtctcctaagctgaagtcgtcttcggaaaccagcgtgcac
tgcacatcatacaggggagtccctgccagcaagccggagcctgccagagccaaggccaag
ctctccaagttcagcatccccaagcagggggaggagagtagatctggagaaaccaacagc
tgtgttgaagaaataatccgggagatgacctggcttccaccactttctgctattcaagca
cctggcaaagtggaaccaaccaaatttccatttccaaataaggactctcagcttgtatcc
tctggacacaataatccaaagaaaggtgatgcagagccagagagtccagacaatggcaca
tcgaatacatcaatgctggaagatgaccttaagctaagcagtgatgaagaggagaatgaa
cagcaggcagctcagagaacggctctccgcgctctctctgacagcgccgtggtccagcag
cccaactgcagaacctcggtgccttccagcaagggcagcagcagcagcagcagcagcggc
agcagcagctcctccagcgactcagagagcagctccggatctgactcggagaccgagagc
agctccagcgagagtgagggcagcaagcccccccacttctccagccccgaggctgaaccg
gcatcctctaacaagtggcagctggataaatggctaaacaaagttaatccccacaagcct
cctattctgatccaaaatgaaagccacgggtcagagagcaatcagtactacaacccggtg
aaagaggacgtccaggactgtgggaaagtccccgacgtttgccagcccagcctgagagag
aaggagatcaagagcacttgcaaggaggagcaaaggccaaggacagccaacaaggcccct
gggagtaaaggcgtgaagcagaagtccccgcccgcggccgtggccgtggcggtgagcgca
gccgccccgccacccgcagtgccctgtgcgcccgcggagaacgcgcccgcgcctgcccgg
aggtccgcgggcaagaagcccaccaggcgcaccgagaggacctcagccggggacggcgcc
aactgccaccggcccgaggagcccgcggccgcggacgcgctggggacgagcgtggtggtc
cccccggagcccaccaaaaccaggccctgtggcaacaacagagcgagccaccgcaaggag
ctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggctaagcaggatcgtcccc
aaatccaaggagttcattgagacagagtcgtcatcttcatcctcctcctcggactccgac
ctggagtccgagcaggaggagtaccctctgtccaaagcacagaccgtggctgcctctgcc
tcctccgggaatgatcagaggctgaaggaggccgctgccaacgggggcagtggtcctagg
gcccctgtaggctccatcaacgccaggaccaccagtgacatcgccaaggagctggaggag
cagttctacacactggtcccctttggccggaacgaacttctctcccctctaaaggacagt
gatgagatcaggtctctctgggtcaaaatcgacctgaccctcctgtccaggatcccagaa
cacctgccccaggagccaggggtattgagcgcccctgccaccaaggactctgagagcgca
ccgcccagccacacctcggacacacctgcagaaaaggctttgccaaaatccaagaggaaa
cgcaagtgtgacaacgaagacgactacagggagatcaagaagtcccagggagagaaagac
agctcttcaagactggccacctccaccagtaatactttgtctgcaaaccactgcaacatg
aacatcaacagtgtggcaataccaataaataaaaatgaaaaaatgcttcggtcgcccatc
tcacccctctctgatgcatctaaacacaaatacaccagcgaggacttaacttcttccagc
cgacctaatggcaacagtttgtttacttcagcctcttccagcaaaaagcctaaggccgac
agccagctgcagcctcacggcggagacctcacgaaagcagctcacaacaattctgaaaac
attcccctccacaagtcacggccgcagacgaagccgtggtctccaggctccaacggccac
agggactgcaagaggcagaaacttgtcttcgatgatatgcctcgcagtgccgattatttt
atgcaagaagctaaacgaatgaagcataaagcagatgcaatggtggaaaagtttggaaag
gctttgaactatgctgaagcagcattgtcgtttatcgagtgtggaaatgcaatggaacaa
ggccccatggaatccaaatctccttatacgatgtattcagaaacagtagagctcatcagg
tatgctatgagactaaaaacccactcaggccccaatgccacaccagaagacaaacaactg
gctgcattatgttaccgatgcctggccctcctgtactggcggatgtttcgactcaaaagg
gaccacgctgtaaagtattcaaaagcactaatcgactatttcaagaactcatctaaagcc
gcccaagccccatctccgtggggggccagtggaaagagcactggaaccccatcccccatg
tctcccaacccctctcccgccagctccgtggggtctcagggcagcctctccaacgccagc
gccctgtccccgtcgaccatcgtcagcatcccacagcgcatccaccagatggcggccaac
cacgtcagcatcaccaacagcatcctgcacagctacgactactgggagatggccgacaac
ctggccaaggaaaaccgagaattcttcaacgacctggatctgctcatggggccggtcacc
ctgcacagcagcatggagcacctggtccagtactcccaacagggcctgcactggctgcgg
aacagcgcccacctgtcatag

DBGET integrated database retrieval system