KEGG   Homo sapiens (human): 39Help
Entry
39                CDS       T01001                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa00620  Pyruvate metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00640  Propanoate metabolism
hsa00650  Butanoate metabolism
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
hsa04975  Fat digestion and absorption
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    39 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    39 (ACAT2)
   00640 Propanoate metabolism
    39 (ACAT2)
   00650 Butanoate metabolism
    39 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    39 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    39 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    39 (ACAT2)
   00310 Lysine degradation
    39 (ACAT2)
   00380 Tryptophan metabolism
    39 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    39 (ACAT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    39 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    39 (ACAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     39 (ACAT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   39 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-GeneID: 39
NCBI-ProteinID: NP_005882
OMIM: 100678
HGNC: 94
Ensembl: ENSG00000120437
Vega: OTTHUMG00000015935
Pharos: Q9BWD1(Tbio)
UniProt: Q9BWD1
Structure
PDB: 

Position
6q25.3
AA seq 397 aa AA seqDB search
MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHV
LAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGME
NMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDK
VAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLT
DGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEPSIMGIGPIPA
IKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASGC
RILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggctcagatcctgtggtcatcgtctcggcggcgcggaccatcataggttcc
ttcaatggtgccttagctgctgttcctgtccaggacctgggctccactgtcatcaaagaa
gtcttgaagagggccactgtggctccggaagatgtgtctgaggtcatctttggacatgtc
ttggcagcaggctgtgggcagaatcctgttagacaagccagtgtgggtgcaggaattccc
tactctgttccagcatggagctgccagatgatctgtgggtcaggcctaaaagctgtgtgc
cttgcagtccagtcaatagggataggagactccagcattgtggttgcaggaggcatggaa
aatatgagcaaggctcctcacttggcttacttgagaacaggagtaaagataggtgagatg
ccactgactgacagtatactctgtgatggtcttacagatgcatttcacaactgtcatatg
ggtattacagctgaaaatgtagccaaaaaatggcaagtgagtagagaagatcaggacaag
gttgcagttctgtcccagaacaggacagagaatgcacagaaagctggccattttgacaaa
gagattgtaccagttttggtgtcaactagaaaaggtcttattgaagttaaaacagatgag
tttcctcgccatgggagcaacatagaagccatgtccaagctaaagccttactttcttact
gatggaacgggaacagtcaccccagccaatgcttcaggaataaatgatggtgctgcagct
gtcgttcttatgaagaagtcagaagctgataaacgtgggcttacacctttagcacggata
gtttcctggtcccaagtgggtgtggagccttccattatgggaataggaccaattccagcc
ataaagcaagctgttacaaaagcaggttggtcactggaagatgttgacatatttgaaatc
aatgaagcctttgcagctgtctctgctgcaatagttaaagaacttggattaaacccagag
aaggtcaatattgaaggaggggctatagccttgggccaccctcttggagcatctggctgt
cgaattcttgtgaccctgttacacacactggagagaatgggcagaagtcgtggtgttgca
gccctgtgcattgggggtgggatgggaatagcaatgtgtgttcagagagaatga

DBGET integrated database retrieval system