KEGG   Homo sapiens (human): 390078Help
Entry
390078            CDS       T01001                                 

Gene name
OR52E6, OR11-58
Definition
(RefSeq) olfactory receptor family 52 subfamily E member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390078 (OR52E6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390078 (OR52E6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390078
NCBI-ProteinID: NP_001005167
HGNC: 15215
Ensembl: ENSG00000205409
Vega: OTTHUMG00000168802
Pharos: Q96RD3(Tdark)
UniProt: Q96RD3 A0A126GVK5
Position
11p15.4
AA seq 313 aa AA seqDB search
MPIANDTQFHTSSFLLLGIPGLEDVHIWIGFPFFSVYLIALLGNAAIFFVIQTEQSLHEP
MYYCLAMLDSIDLSLSTATIPKMLGIFWFNIKEISFGGYLSQMFFIHFFTVMESIVLVAM
AFDRYIAICKPLWYTMILTSKIISLIAGIAVLRSLYMVIPLVFLLLRLPFCGHRIIPHTY
CEHMGIARLACASIKVNIMFGLGSISLLLLDVLLIILSHIRILYAVFCLPSWEARLKALN
TCGSHIGVILAFSTPAFFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHI
RETVLRIFFKTDH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagctaacgacacccagttccatacttcttcattcctactgctgggtatccca
gggctagaagatgtgcacatctggattggattcccttttttctctgtgtatcttattgca
ctcctgggaaatgctgctatcttctttgtgatccaaactgagcagagtctccatgagccc
atgtactactgcctggccatgttggattccattgacctgagcttgtctacggccaccatt
cccaaaatgctgggcatcttctggttcaatatcaaggaaatatcttttggaggctacctt
tctcagatgttcttcatccatttcttcactgtcatggagagcatcgtattggtggccatg
gcctttgaccgctacattgccatttgcaaacctctttggtacaccatgatcctcaccagc
aaaatcatcagcctcattgcaggcattgctgtcctgaggagcttgtacatggtcattcca
ctggtgtttctcctcttaaggttgcccttctgtggacatcgtatcatccctcatacttac
tgtgagcacatgggcattgcccgtctggcctgtgccagcatcaaagtcaacattatgttt
ggtcttggcagtatttctctcttgttattggatgtgctccttattattctctcccatatc
aggatcctctatgctgtcttctgcctgccctcctgggaagctcgactcaaagctctcaac
acctgtggctctcacattggtgttatcttagccttttctacaccagcatttttctctttc
tttacacactgctttggccatgatattccccaatatatccacattttcttggctaatcta
tatgtggttgttcctcccaccctcaatcctgtaatctatggggtcagaaccaaacatatt
agggagacagtgctgaggattttcttcaagacagatcactaa

DBGET integrated database retrieval system