KEGG   Homo sapiens (human): 390113Help
Entry
390113            CDS       T01001                                 

Gene name
OR4X1, OR11-104
Definition
(RefSeq) olfactory receptor family 4 subfamily X member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390113 (OR4X1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390113 (OR4X1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390113
NCBI-ProteinID: NP_001004726
HGNC: 14854
Ensembl: ENSG00000176567
Vega: OTTHUMG00000165301
Pharos: Q8NH49(Tdark)
UniProt: Q8NH49
Position
11p11.2
AA seq 305 aa AA seqDB search
MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFF
LSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDR
YVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVH
PVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCAS
HVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI
GGKVI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggttgctacaaacaatgtgactgaaataattttcgtgggattttcccagaattggagt
gagcagagggtcatttctgtgatgtttctcctcatgtacacagctgttgtgctgggcaat
ggcctcattgtggtgaccatcctggccagcaaagtgctcacctcccccatgtatttcttt
ctcagctacttatcctttgtggagatctgctactgttctgtcatggcccccaagcttatc
tttgactcctttatcaagaggaaagtcatttctctcaagggctgcctcacacagatgttt
tccctccatttctttggtggcactgaggcctttctcctgatggtgatggcctatgaccgc
tatgtggccatctgcaagcccttgcactacatggccatcatgaaccagcgaatgtgtggt
ctcctcgtgaggatagcatggggcgggggcctgctgcattctgttgggcaaaccttcctg
attttccagctcccgttctgtggccccaacatcatggaccactacttctgtgatgtccac
ccagtgctggagctggcctgcgcagacaccttcttcattagcctgctgatcatcaccaat
ggcggctccatctccgtagtcagtttcttcgtgctgatggcttcctacctgatcatcctg
cacttcctgagaagccacaacttggaggggcagcacaaggccctctccacctgtgcctct
catgtcacagttgtcgacctgttcttcataccttgctccttggtctatattaggccctgt
gtcaccctccctgcagacaagatagttgctgtattttatacagtggtcacacctctctta
aaccctgtgatttactccttcaggaatgctgaagtgaaaaatgccatgaggagatttatt
gggggaaaagtaatttga

DBGET integrated database retrieval system